KEGG   Pseudomonas aeruginosa LESB58: PLES_07261Help
Entry
PLES_07261        CDS       T00818                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase A
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pag00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    PLES_07261 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PLES_07261 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    PLES_07261 (ddlA)
Enzymes [BR:pag01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PLES_07261 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:pag01011]
 Precursor biosynthesis
  Amino acid ligase
   PLES_07261 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
791147..792187
Genome map
AA seq 346 aa AA seqDB search
MGQDKLKVAVLFGGSSEERDVSIASGAQVIQALRSAGHQVLAVDTASGLLGAEEERRLLA
SKVKEVPPDSDSLAIIRSGKQSLLSAGELAGVDVFFLALHGGTGEDGTLQALLDAGGFAY
TGSGHLASAMAMDKDVAKRLFLAAGVETASWLMAPASEEAVREQLGFPLVVKPNSQGSTV
GLSIVHSQAELQPAIELAGRYGDEVMLERFVAGREVTVGVLDDQALPVGEILLGGQEVFD
YEHKYQAGAVREVFPADLPPAIAAEAQRLALKVHRALKLSGYSRTDFRLDEQGRLWCLEV
NTLPGMTATSLLPQAAAAAGIGFAELCERICRLGIERCKGARKARS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgggacaggacaagttgaaggtcgccgttctcttcggcggcagcagtgaggaacgggac
gtctccatcgccagcggcgcgcaggtgatccaggcgttgcgcagcgccggccaccaggtg
ctggcggtggataccgccagcggcctgctcggcgcggaggaagagcgccgcctgctggcg
agcaaggtcaaggaggtcccgccggactccgactcgctggcgatcatccgcagcggcaag
cagagcctgctgagcgccggcgaactggctggggtcgacgtgttcttcctcgccctgcac
ggcggcaccggcgaggacggcaccctgcaggcgctgctggatgccggcggtttcgcctat
accggcagcggccacctggccagcgccatggcgatggacaaggacgtggccaagcgcctg
ttcctcgccgccggggtggagaccgccagttggctgatggcgccggcctcggaagaggcg
gtgcgcgagcaactgggcttccccctggtggtcaagccgaacagccagggctccaccgtg
gggctgtccatcgtgcattcccaggccgaattgcagccggccatcgagctggccgggcgc
tatggcgacgaggtgatgctggagcgcttcgtcgccggccgcgaggttaccgtcggggtg
ctcgacgaccaggcgctgccggtgggcgagattctcctcggtggccaggaagtcttcgac
tacgaacacaagtaccaggccggcgcggtgcgcgaggtgtttcctgccgacctgccgccg
gcgatcgccgccgaggcccagcgtctggcgctgaaggtacaccgggcgctgaagctgagc
ggctacagccgcaccgacttccgcctcgacgaacagggccggctctggtgcctggaggtc
aataccctgccgggaatgaccgccaccagcctgctgccgcaggccgcggcggcggccggg
attgggttcgccgaactctgcgagcggatctgccggctcggtatcgagcgctgcaagggc
gcgcgcaaggcgcgttcctga

DBGET integrated database retrieval system