KEGG   Pyrobaculum aerophilum: PAE0833Help
Entry
PAE0833           CDS       T00073                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai03030  DNA replication
pai03410  Base excision repair
pai03420  Nucleotide excision repair
pai03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pai00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PAE0833
   03410 Base excision repair
    PAE0833
   03420 Nucleotide excision repair
    PAE0833
   03430 Mismatch repair
    PAE0833
Enzymes [BR:pai01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PAE0833
    6.5.1.6  DNA ligase (ATP or NAD+)
     PAE0833
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PAE0833
DNA replication proteins [BR:pai03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PAE0833
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PAE0833
DNA repair and recombination proteins [BR:pai03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PAE0833
   NER (nucleotide excision repair)
    Other NER factors
     PAE0833
   MMR (mismatch exicision repair)
    Other MMR factors
     PAE0833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2 PocR
Motif
Other DBs
NCBI-ProteinID: AAL63064
UniProt: O93723
LinkDB All DBs
Position
479299..481053
Genome map
AA seq 584 aa AA seqDB search
MQFGELVKALAAIEATTQRTTMVKLLVSLFKKASPEEVGKIVYFILGDLRPPWEGVELGV
AEKLCLRAVSKATGAAVSELEALYKKTGDVGEAARRALAASKRPGLLAFGSQKPLEVSEV
YDTLLKVARATGEGAQDMKVALLSSLFARATPEEGKYIARFVVGKLRLGVADMTIIEALS
DAYGVNKEALEKAYHIYPDLGRLAKHVAEGKPLDEIRITPGVPVLPMLAQRLSSASEILA
KLGGSAICEYKYDGERAQIHLTPGGVKIFSRRLEDITHAYPDVVKAVKEAVSAKEAILEG
EIVAVDPDTGDMLPFQELMHRKRKHDVATAVELYPTVLYLFDVLYVDGEDLTEEPLIYRR
VRLSEIVCETDKVSIAKWRIFDNAEAVDVFFHESVSMGTEGLICKSPSSIYEMGARGWNW
IKYKRDYRSEMIDTVDLVVVGAFHGRGKRAGLYGAFLLAAYDPSTDMFYTVCKVGSGFTD
ADLKKMYEILQPFKIPHRHPRVVSKMEADVWFVPQVVIEVIGAEITLSPLHTCCLGAVRP
GVGLAVRFPRFTGRYRSDKSPEQATTVAEMLELYKRQKKVVQPE
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
gtgcagtttggggagttagttaaggcacttgcggcaattgaggccaccactcagaggaca
acaatggtcaagttgctcgtctcgctttttaaaaaggcgtctccagaggaggtcgggaaa
attgtgtacttcatcctcggcgatttgaggcctccttgggagggggttgagttgggggtt
gctgagaagctctgtttgagggcggtttctaaggccacgggggcggccgtatccgagctg
gaggctttgtataagaaaacgggcgacgtgggcgaggcggcgcgtcgcgccttggccgcg
tctaaacgccctggtttactggcctttggctctcaaaagccgcttgaggtgtctgaagtt
tacgacacgttgttaaaagtggccagggcaacgggggagggggctcaagatatgaaagtg
gctttgctgtcctctctctttgccagggcgactccagaggaggggaagtacattgccaga
tttgttgtggggaagttgaggctgggcgtcgccgacatgactattattgaggcgctttca
gacgcctacggagttaataaggaggctttagaaaaggcgtatcacatataccccgactta
ggccggctggctaaacacgtcgccgagggcaagccgcttgacgaaataagaattactccc
ggcgtgccggtgcttcccatgttggcgcagaggctgtcttccgcctctgagattttggct
aagctgggcggctcggcgatttgcgagtataaatacgacggagagagggcccagatacac
ctcactccaggcggcgtgaaaatattcagcaggaggcttgaggacatcacccacgcctat
cccgatgttgtcaaggcggttaaagaggctgtgtccgcaaaggaggcgattttagagggg
gagatagtggctgttgatcccgatactggggacatgttgccttttcaagagcttatgcat
aggaagaggaaacacgatgtggcaacagccgtggagctgtaccccacagtgttgtattta
tttgacgtcttgtacgtcgacggcgaggatttaacagaagagcctcttatatacaggagg
gtgaggctttctgaaattgtctgcgagactgacaaggtgtcaatagccaagtggagaatt
tttgacaacgccgaggctgttgacgtctttttccacgagtctgtgtctatgggcactgag
ggcttgatatgtaaatcgccttcttcaatttacgaaatgggggccaggggctggaactgg
attaaatacaagcgggattaccgtagcgagatgatagatacagtagacctcgttgtagta
ggcgccttccacggcaggggcaagagggccggcctatacggcgcctttctcttggcggca
tacgatccttccactgacatgttttatactgtgtgtaaagttggaagtgggtttacagac
gccgatttgaaaaaaatgtacgagattttgcagccgtttaaaatcccccacagacacccc
agagttgtgtctaaaatggaggcggatgtgtggttcgtgccccaggtagttattgaggtt
ataggggctgagattactctgtcgcctctccacacttgctgtttaggcgcagtgcgcccg
ggggttgggctggcggttagattccccagatttactggccgttatagatctgacaaatcc
ccagagcaagcaacgacggtggcggagatgttagagctgtacaagaggcagaaaaaagtg
gttcagcccgagtag

DBGET integrated database retrieval system