KEGG   Providencia alcalifaciens: CO695_15825Help
Entry
CO695_15825       CDS       T05107                                 

Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pala  Providencia alcalifaciens
Brite
Enzymes [BR:pala01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CO695_15825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3361474..3362052
Genome map
AA seq 192 aa AA seqDB search
MSFELPALPYAKDALEPHISAETLEYHYGKHHNTYVVNLNNLIKGTKFEGLSLEEIIKTS
DAGVFNNAAQVWNHTFYWHCLAPNAGGEPTGKVAEAINKAFGSFAQFKEQFTDAAVKNFG
AGWTWLVKKADGSLAIVNTSNAATPISGDDKPVLTVDIWEHAYYIDYRNARPKYLENFWA
LVNWKFVEENLA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttgaattaccagctctaccttatgctaaagatgctttagaaccgcatatctct
gctgaaaccttagaatatcactatggtaagcaccacaacacatatgttgttaacctgaac
aacctgatcaaaggcaccaaatttgaaggtctgtctttagaagaaatcatcaaaacttct
gacgctggcgtattcaataacgcggctcaagtttggaatcacactttctactggcactgc
ttagcaccaaatgcaggtggcgaaccaacaggtaaagttgctgaagctatcaacaaagca
ttcggttcattcgctcagttcaaagagcaattcactgatgccgcagttaaaaacttcggt
gcaggttggacttggttagtgaaaaaagcagatggtagcctcgctatcgtcaacacctct
aacgcagcaacaccaatctctggtgacgacaagcccgttctgactgttgatatctgggaa
cacgcttactacatcgattaccgtaacgcgcgtccaaaatacttagaaaatttctgggcg
ctggttaactggaaatttgttgaagaaaatctggcttaa

DBGET integrated database retrieval system