KEGG   Pteropus alecto (black flying fox): 102880255Help
Entry
102880255         CDS       T02993                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:pale00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    102880255 (ACE)
   04614 Renin-angiotensin system
    102880255 (ACE)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    102880255 (ACE)
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    102880255 (ACE)
Enzymes [BR:pale01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     102880255 (ACE)
Peptidases [BR:pale01002]
 Metallo Peptidases
  Family M2
   102880255 (ACE)
Exosome [BR:pale04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102880255 (ACE)
CD molecules [BR:pale04090]
 Proteins
  102880255 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1262 aa AA seqDB search
MERSTKQTAFPQEEAALLNQEFSEVWGQKAKELYDPIWQNFTDPVLKRVLKGVRILGPAN
LPLEKRQKYNSLLSNMNRIFSTVKVCYPNRNDTCWSLDPDLMHILSISRNYGLLLYAWEG
WHNAVGIPLKPLYEEFTALSNEAHKQDGFSDTGDYWRSWYESPTFVEDLEHLYHQLEPLY
LNLHAYVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWDNIYDMVVPFPDKPNLDVTST
MVQKGWNATHMFRVAEEFFTSLGLLPMPPEFWAESMLEKPSDGRQVVCHASAWDFYNRKD
FRIKQCTRVSMDQLSTVHHEMGHVQYYLQYKDQPVSLRQGANPGFHEAIGDVLALSVSTP
AHLHKIGLLDHVVNDTESDINYLLKMALEKVAFLPFGYLVDQWRWGVFSGRTPPSRYNFD
WWYLRTKYQGICPPVVRNETHFDAGAKFHVPHVTPYIRYFVSFVLQFQFHQALCKEAGHQ
GPLHRCDIYQSTKAGDKLRKVLRAGSSQPWQDVLKDMIGSDTLDAQPLLSYFQPVSQWLQ
EQNQKNKEVLGWPEYQWQPPMPDDYPEDIALVTDEAEASKFVEEYDQISQVVWNEYAEAN
WNYNTNITSEASKILLQKNIQMANHTLKYGTRAKRFDVTYFQNTTMKRIIHKIQDLERAA
LPAKELEEYNQILLDMETTYSVASVCHSNGTCLQLEPDLTNLMATSRNYEELSWAWKGWR
DEVGRSILPFFPKYVELSNKAARLNGYTDAGDSWRSVYEMPTLEQDLEQLFQELRPLYLN
LHAYVRRALHRHYGPQRINLEGPIPAHLLGNMWAQTWSNIYDLVIPFPSAPKMDATEAMI
KQGWTPKKMFEEANDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFR
IKQCTTVNMEDLVVAHHEMGHIQYFMQYKDLPVTFREGANPGFHEAIGDVLALSVSTPKH
LHSINLLSSDGDSYEQDINFLMKIALDKVAFVPFSYLIDQWRWRVFDGGITKDNYNQEWW
SLRLKYQGLCPPVARSQGDFDPGAKFHIPSSVPYIRYFVGFIIQFQFHEALCQAAGHKGP
LHKCDIYQSKEAGKRLADAMKLGFSKPWPEAMKLITGQPNMSASAMMNYFKPLLDWLLTE
NGRHGEKLGWPQYNWTPDSGTTTTPTSAPGRPPELTQDQAPSPAQAARSESPFPGHGRVN
FLGLNLEEQQARVGQWVLLFLGVALLVATLGLTQRLFSIRHHNLRRPHRGPQFGSEVELR
HS
NT seq 3789 nt NT seq  +upstreamnt  +downstreamnt
atggagcgatccactaagcagactgcatttcctcaggaggaagccgctctgctcaaccag
gagttttctgaggtctggggccagaaggccaaggagctgtacgacccaatctggcagaac
ttcactgacccagtactgaaaagggtcctcaaaggtgtgcgcattctgggccctgccaac
ctgcccctggagaagcggcagaagtacaattctctactaagcaacatgaacagaatcttt
tccactgtcaaggtctgctaccccaacaggaatgacacctgctggtctctggacccagat
ctcatgcatatcctgtctatctcaagaaactacggcctgctgctctatgcctgggagggc
tggcacaatgccgtgggcatcccactgaaacccctgtatgaggagttcactgccctcagc
aacgaggcccacaagcaagatggcttctcagacacaggggactactggcgctcctggtat
gaatcacccaccttcgtggaggatctggagcacctctaccatcagttagagcccctctac
ctgaacctccatgcctatgttcgccgtgcactgcaccgccgctatggggaccgatacatc
aacctcagaggacccatccccgctcacctgctgggggacatgtgggcccagagctgggac
aacatctatgacatggtggtgcctttccctgacaagcccaatctcgatgtgaccagtact
atggtgcagaagggctggaacgccacacacatgttccgggtggcggaggagttcttcacc
tccctggggctcctgcccatgcctcctgagttctgggcagagtccatgctggaaaaacca
agcgacggacgtcaggtggtgtgccatgcttccgcctgggacttctacaacaggaaagac
ttcaggatcaagcagtgcacacgggtctctatggaccagctgtccacagtgcaccacgag
atgggccacgtgcagtactacctgcagtacaaggaccagcctgtctccctgcgccaaggt
gccaaccctggcttccacgaggccattggggatgtgctggcgctgtctgtctccactcct
gcacatctgcacaaaattggcctgctggaccatgtcgtcaatgatacggaaagcgacatc
aattacttgttaaagatggcactggaaaaagttgccttcttgcccttcggctatctggtg
gaccagtggcgttggggggtctttagcggacgtacccccccttcccgttacaattttgac
tggtggtatcttcgaactaagtatcagggcatctgtcctccagtcgtccgaaacgaaact
catttcgatgccggagctaagtttcacgtcccccatgtgacaccgtacatcaggtacttt
gtgagttttgtcctgcagttccagttccaccaagccctgtgcaaggaggcaggccaccag
gggccactgcaccgctgtgacatctaccagtccaccaaggcgggggacaagctccggaaa
gtgctacgggcaggctcctcacagccttggcaggacgtactaaaggatatgatcggctca
gataccctggatgctcagccactgctcagctacttccagccggtcagccagtggctacag
gagcagaaccaaaagaacaaagaggtcctgggctggccggaatatcagtggcagccacca
atgcctgacgattacccagaggacattgccctggtgactgacgaggccgaggccagcaag
tttgtggaggaatatgaccagatatcccaggtggtatggaacgagtatgcggaggccaac
tggaactacaacaccaacatcacctcagaggccagcaagatcctgctacagaagaacata
cagatggcaaaccacaccttaaagtatggcacccgggccaagcggtttgatgtgacctat
ttccagaacaccaccatgaagcggataatacacaagattcaggacctagagcgtgcagcg
ctgcctgccaaggagctggaggagtacaaccaaatcctgctggacatggaaaccacttac
agtgtggcctctgtgtgccactccaatggcacttgtctgcagctagagcctgatctgacg
aatctgatggccacatcccggaactatgaagaactgtcatgggcatggaagggctggcga
gacgaggtgggaagatccatcctcccttttttccccaaatatgtggaactctccaacaag
gccgcccggctcaatggctacacagacgcaggggactcatggagatctgtgtatgagatg
ccaaccctcgagcaagacctggagcagctcttccaggagctgcggccgctctacctgaac
ctgcacgcctacgtgcgccgggccctgcaccgccactacgggccccagcgcatcaaccta
gagggccccattcccgcgcacctgctggggaacatgtgggcgcagacctggtccaacatc
tatgacttagtgatacccttcccttcggcccccaagatggacgccacggaggccatgata
aagcagggctggacacccaaaaagatgtttgaggaagcaaacgatttcttcacctccctg
gggctgctgcctgtgccccctgagttctggaacaagtcgatgctggagaagccgaccgat
gggcgagaagtggtgtgccatgcctctgcctgggacttctacaatggcaaggacttcagg
atcaagcagtgtaccactgtgaacatggaggacctggtggtagcccaccatgaaatgggc
cacatacagtatttcatgcagtacaaggacttgcctgtgaccttccgggagggcgccaac
cctggctttcacgaggccatcggggatgtgctggccctctcagtgtctacccccaagcac
ctgcacagcatcaacctgctgagcagcgatggtgacagctatgagcaagacatcaacttt
ctgatgaagatagcgctcgacaaggtcgcatttgtccccttcagctacctcatcgaccag
tggcgctggagggtctttgacggaggcatcaccaaggacaactacaaccaggagtggtgg
agcctcaggctgaaataccagggcctctgccccccggtggccaggtctcaaggcgacttt
gacccgggcgccaagttccacattccttcaagtgtgccttatatcaggtactttgttggc
ttcatcatccagtttcagttccacgaggcgctgtgtcaggcagctggccacaagggcccc
ctgcacaagtgtgacatctaccagtccaaggaggcagggaagcgcctggcggacgccatg
aagctgggcttcagtaaaccctggccggaagccatgaagctgattacgggccagcccaac
atgtccgcctcagccatgatgaactacttcaagccactgctagactggctcctcacggag
aacgggcggcacggggagaagctgggctggcctcagtacaactggacaccagactccggt
accaccaccacccccacctcagccccgggccggcccccagagctcactcaggaccaggcc
ccctccccagctcaggcagctcgctcggagagccccttcccgggccacggccgcgtcaac
ttcctgggtctgaacctggaggagcagcaggcccgggtgggccagtgggtgctgctcttc
ctgggcgtcgccctgctggtggccaccttgggcctcacccagcggctcttcagcatccgc
caccacaacctccgccggccccaccgcgggccccaattcggctctgaggtggaactgaga
cactcctga

DBGET integrated database retrieval system