Pteropus alecto (black flying fox): 102891169 Help Entry 102891169         CDS       T02993                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism pale  Pteropus alecto (black flying fox) Pathway pale04015   Rap1 signaling pathway pale04810   Regulation of actin cytoskeleton pale05014   Amyotrophic lateral sclerosis pale05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pale00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102891169 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102891169 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102891169 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102891169 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pale04131]     102891169 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pale04812]     102891169 (PFN1)    04147 Exosome [BR:pale04147]     102891169 (PFN1) Membrane trafficking [BR:pale04131]  Others   Actin-binding proteins    Others     102891169 (PFN1) Cytoskeleton proteins [BR:pale04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102891169 (PFN1) Exosome [BR:pale04147]  Exosomal proteins   Proteins found in most exosomes    102891169 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102891169 NCBI-ProteinID:  XP_006922311 UniProt:  L5JWP8 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgttcccgggaaaaccttc gtcaacatcacgccagctgaggttggtgtcttggttggcaaagaccggtcaagttttttc gtgaatgggctgacacttgggggccagaaatgttctgtgattcgggactcactgctgcag gatggggaatttaccatggatcttcgtaccaagagcaccggcggagcccccaccttcaat atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggcggtatgatcaacaagaaatgttatgaaatggcctctcacctgcggcgttcccagtac tga

DBGET integrated database retrieval system