KEGG   Pteropus alecto (black flying fox): 102898766Help
Entry
102898766         CDS       T02993                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pale  Pteropus alecto (black flying fox)
Pathway
pale00010  Glycolysis / Gluconeogenesis
pale00051  Fructose and mannose metabolism
pale00052  Galactose metabolism
pale00500  Starch and sucrose metabolism
pale00520  Amino sugar and nucleotide sugar metabolism
pale00524  Neomycin, kanamycin and gentamicin biosynthesis
pale01100  Metabolic pathways
pale01200  Carbon metabolism
pale04066  HIF-1 signaling pathway
pale04910  Insulin signaling pathway
pale04930  Type II diabetes mellitus
pale04973  Carbohydrate digestion and absorption
pale05230  Central carbon metabolism in cancer
Module
pale_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pale_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pale00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102898766 (HK1)
   00051 Fructose and mannose metabolism
    102898766 (HK1)
   00052 Galactose metabolism
    102898766 (HK1)
   00500 Starch and sucrose metabolism
    102898766 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    102898766 (HK1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102898766 (HK1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    102898766 (HK1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102898766 (HK1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    102898766 (HK1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    102898766 (HK1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102898766 (HK1)
Enzymes [BR:pale01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102898766 (HK1)
Membrane trafficking [BR:pale04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102898766 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 102898766
NCBI-ProteinID: XP_015447763
LinkDB All DBs
Position
Un
AA seq 916 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLIDIMTRFKREMKHGLSRDFNATAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNLEKNKNVHMESETYETAEDIMH
GSGSQLFDHVAECLGDFMEKRKIKDLEVLDAFQLSSKPICSPLQGILITWTKRFKVSGVE
GADVVKLLNKAIKKRGDYDANVVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYMEE
LRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMISGMY
LGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLQNAKEILTRLGV
EPSDDDCVSVQHVCTIVSFRSANLVAATLATILNRLRDNKGSPRLRTTVGVDGSLYKTHP
QYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFCLTK
EMLLEVKKRMRIEMEMGLKKKTHDKAVVKMLPSFVRSIPDGTEHGDFLALDLGGTNFRVL
LVKMRSGKKRTVEMHNKIYAIPTEIMQGTGEELFDHIVSCISDFLDYMGIKGPRMPLGFT
FSFPCKQTSLDEGILITWTKGFKATDCVGHDVATLLRDAIKRREEFDLDVVAVVNDTVGT
MMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMLEGNEGQMCINMEWGAFGDNGCLDDI
RTNYDRVVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRGI
FQTKYLSQIESDRLALLQVRSILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAAV
VDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKGA
ALITAVGVRLREGMSS
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcctattacttcaccgagctgaaggatgaccaagtcaaa
aagattgacaagtatctctatgccatgcggctctccgatgaaactctgatagatatcatg
actcgtttcaagagggaaatgaagcacggtctttcccgggattttaatgcgacagccaca
gtcaagatgttgccaacgtttgtaaggtccattcctgatggttcagaaaagggagatttc
attgccctggatcttggtgggtcttcctttcgaattctgcgagttcaagtgaatctggag
aaaaacaagaatgttcacatggaatctgagacttatgagactgcggaggatatcatgcat
ggcagtggaagccagctttttgatcatgttgctgagtgcctgggagatttcatggaaaaa
agaaaaatcaaggacctagaggttctggatgccttccagctttcatcaaaacccatctgt
tctcctttgcagggtatcctgatcacctggacaaagcgatttaaagtgagcggagtggag
ggagcagatgtggtgaagctgcttaacaaagccatcaaaaaacgtggggattacgatgcc
aatgttgtggctgtggtgaatgacacagtggggaccatgatgacctgtggctatgatgac
cagcagtgtgaagttggcctcatcattggcactggcactaatgcttgctacatggaggag
ctgaggcacattgacctggtggaaggtgacgaggggaggatgtgcatcaacaccgagtgg
ggggcctttggggacgatgggtccctggaagacatccgcaccgagtttgaccgtgagata
gaccggggatctctcaaccctggaaaacaactgtttgaaaagatgatcagtggcatgtac
ctgggagagctggttcgactgatcctggtcaagatggccaaggagggccttttatttgaa
gggcggatcaccccagagctgctcaccagagggaagtttaacaccagtgatgtgtcagcc
attgaaaagaataaggaaggccttcaaaatgccaaagaaatcctgacccgcctgggagtg
gagccatctgacgacgactgcgtttcggtccagcacgtgtgcaccattgtctcattccgc
tctgccaacctggtggctgcgacgctggccaccatcttgaatcgccttcgcgataacaag
ggctctcccaggctgcggaccacggttggtgtcgacgggtctctttacaagacgcaccca
cagtattcccggcgtttccataagacgctgaggcgcttggtgcctgactccgacgtgcgt
ttcctcctctcggagagtggcagtggcaagggggccgccatggtgactgcagtggcttac
cgcctggccgagcagcaccggcagatagaggagaccctggcccacttctgcctcaccaag
gaaatgctgctggaggtgaagaagaggatgcggattgagatggaaatggggctaaagaag
aagacacacgataaggccgtagtcaagatgctgccctccttcgtccggagtattccagat
gggactgagcatggtgacttcttggccctggatcttggaggaacaaatttccgcgtcctg
ctggtaaaaatgcgtagtgggaaaaagagaacagtcgaaatgcacaacaagatctatgcc
attcccactgaaatcatgcagggcaccggggaagagctgttcgaccacatcgtctcctgc
atctccgacttcctggactacatggggatcaaaggccccagaatgcctctgggcttcacg
ttctcatttccctgcaagcagacgagcttggatgaggggatcttgattacctggaccaag
gggtttaaggccaccgactgcgtggggcacgatgtagccaccttgctaagggatgcgata
aaaaggagagaggaatttgatctggacgtggtggctgtagtcaacgacacggtgggcacc
atgatgacctgtgcttatgaggagcccacctgtgaggttggactcatcgtagggactggc
agcaatgcctgctacatggaagaaatgaagaacgtggagatgctggaggggaacgaagga
caaatgtgtatcaatatggagtggggtgcctttggggacaacgggtgtctggatgatatc
agaacaaactatgacagagtggtggatgaatattctctgaatgctggaaaacaaaggtat
gagaagatgatcagtggcatgtacctgggtgaaattgtccgcaacatcctgatcgacttc
actaagaagggattcctcttccgagggcagatctctgagccgctgaagactcggggcatc
tttcagaccaagtatctctctcagatcgagagtgaccgattagcgctgctccaggtccga
agcatcctccagcagctgggcctgaatagcacctgcgatgacagtatcctcgtcaagacc
gtgtgtggggtggtgtccaagagggccgcgcagctgtgtggcgcaggcatggctgccgtg
gtggacaagatccgagagaacagagggctggaccgtctcaatgtgactgtgggggtggat
ggaacactctacaagcttcatccacacttctccagaatcatgcaccaaaccgtgaaggaa
ctgtcaccaaaatgtaatgtgtccttcctcctgtcggaagatggtagtggcaagggggct
gccctcatcacggcagtgggcgttcggctccgagaaggaatgagcagctaa

DBGET integrated database retrieval system