KEGG   Pseudomonas alkylphenolica: PSAKL28_09280Help
Entry
PSAKL28_09280     CDS       T03238                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
palk  Pseudomonas alkylphenolica
Pathway
palk00473  D-Alanine metabolism
palk00550  Peptidoglycan biosynthesis
palk01100  Metabolic pathways
palk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:palk00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    PSAKL28_09280
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PSAKL28_09280
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    PSAKL28_09280
Enzymes [BR:palk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PSAKL28_09280
Peptidoglycan biosynthesis and degradation proteins [BR:palk01011]
 Precursor biosynthesis
  Amino acid ligase
   PSAKL28_09280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_Ter ATP-grasp_3 ATP-grasp ATPgrasp_YheCD RimK TTL ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AIL60159
UniProt: A0A077F8F4
LinkDB All DBs
Position
1016261..1017220
Genome map
AA seq 319 aa AA seqDB search
MTDNAYATLHSTIAAKDFGRVAVLYGGKSAEREVSLKSGAAVIEALTSAGVDVVAIDVGD
DLLDRLQSEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVW
HSLGIPTPRHAVLTSEADCISAGAELGFPLIVKPAHEGSSIGMAKVNGVDELIAAWKDAA
TYDSQVLVEQWIHGPEFTVATLRGQVLPPIALGTPHTFYDYDAKYLASDTQYRIPCGLSA
EKENELIDLTARACDAIGIAGWGRLDVMQDEQGRFWLLEVNTAPGMTDHSLVPMAARAAG
LDFQQLVLAILAASVEARG
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgactgataacgcatacgccacattgcactcgaccattgccgcgaaagacttcggccgc
gttgccgtgctttacggcggcaagagtgccgaacgcgaagtttcgctgaagtccggggca
gcagtcatcgaagcgctgaccagcgccggtgtcgacgtggtcgcaatcgatgtgggcgat
gacctgctcgatcgcctgcaaagcgagaagatcgaccgtgccttcatcatcctccacggc
cgtggcggtgaagacggcagcatgcagggcctgctggagtgtctgggcatcccttacacc
ggcagtggcatcctcgcttcggcgctggccatggacaagctgcggaccaaacaggtctgg
cacagcctgggtattccgaccccgcgtcatgccgtgctgaccagcgaagccgactgtatt
tctgcaggtgcggaactgggcttccctttgatcgtcaaaccggcccatgaaggctccagt
atcggtatggcgaaagtgaacggtgtcgacgaattgatcgccgcctggaaggacgccgct
acctacgattcgcaagtgttggtcgaacaatggattcacggtccggagttcaccgtggcg
accctgcgtggccaggtattgccaccgatcgcgctgggcacgccgcacactttctacgac
tacgacgccaagtacctggcttccgatacccagtaccggatcccgtgtggcttgagcgcg
gagaaggaaaacgaactgatcgacctgaccgcccgtgcctgcgacgccatcggcatcgct
ggctgggggcggctggacgttatgcaggacgagcaggggcgtttctggctgctcgaagtc
aacaccgcaccaggcatgacggatcacagcctggtccctatggcggcacgcgcggccggt
ctggacttccagcaattggtgctggcaatcctggcggccagcgtcgaggcgcgaggttaa

DBGET integrated database retrieval system