KEGG   Pseudoalteromonas aliena: B0W48_14515Help
Entry
B0W48_14515       CDS       T04815                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
paln  Pseudoalteromonas aliena
Brite
Enzymes [BR:paln01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     B0W48_14515
Peptidases [BR:paln01002]
 Metallo Peptidases
  Family M2
   B0W48_14515
Exosome [BR:paln04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B0W48_14515
CD molecules [BR:paln04090]
 Proteins
  B0W48_14515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3200813..3202660)
Genome map
AA seq 615 aa AA seqDB search
MNTPRHKLSISAFMVASTLALVACDAEITIDTKDSAHTKKAVTAKDANVFIANTEKELSA
LYLESSRAEWIYANFITHDTSALSAEVNRKMTETVVRLANEAAKYDALVLDYDARRKLDK
LKLALTLPAPQDADKTAQLSNIVAQLGGLYGKGKYCKEDGSCLSLGDMTSTMATSRDYNE
LLDLWEGWRQISKPMRPLYAQQVVLTNEGAKELGYVDTGAMWRSKYDMPADDFTTELDRI
WGQVKPLYNSLHCHVRAKLGEKYGTDKVPQNQPIPAHLLGNMWAQAWGNIYDVVAPENAD
PGYDVTELLAKHDYDELKMVKGAESFFTSMGFDALPTTFYERSLFIKPKDRDVQCHASAW
NIDSKDDLRIKMCIQRTGEEFSVIHHELGHNFYQRAYNKQPLFYQESANDGFHEAIGDTI
ALSVTPGYLNEIGLLEQVPDESKDIGLLMKMALDKVAFVPFSLMVDQWRWQVFSGEVTPE
NYNKAWWELREKYQGVQAPIARSENDFDPGAKYHVPGNTPYTRYFLAHILQFEFHRSLCE
IAGNDKAIHRCSIYNSKEAGDKLNAMLEMGSSRPWQEALETITGKPQMDATAMLDYFAPL
QTYLDKQNEGRNCGW
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
atgaacacacctcgccataagctgagtataagcgcctttatggtcgcaagtactcttgct
ttagttgcctgcgacgcagaaataaccatagacaccaaagactcagcacacactaaaaaa
gctgttacagctaaagatgctaacgtatttattgcaaacaccgagaaagaactcagtgca
ctttatttagagtcaagtcgggcagaatggatttacgctaactttattactcacgatacg
tcagctttatctgctgaggttaatcgtaaaatgaccgaaactgttgtgcgcttagccaac
gaagcggctaaatacgatgcactcgtccttgattacgatgcccgccgaaaacttgataaa
ctaaaactagcccttacattgccagcaccacaagacgcagataaaacagcacaactttca
aatattgttgcacaacttggtggtttatacggtaaaggtaaatactgcaaagaagatggc
agctgtttgagcctaggcgacatgacatctacaatggcaaccagccgagattacaacgaa
ctacttgatttatgggaaggttggcgtcaaatatcaaagccaatgcgcccactttacgcg
caacaagtagtcctgacaaacgaaggggcaaaagagcttggttatgttgataccggcgca
atgtggcgcagtaaatacgatatgcctgctgatgacttcaccaccgagcttgatcgtatt
tggggccaagttaaaccactgtataactcactgcactgccatgttcgcgcaaagttaggt
gaaaagtacggcacagacaaagtaccacaaaatcaacctattccagcgcacttacttggt
aatatgtgggcgcaagcatggggtaatatttacgatgtagttgcaccagaaaacgctgat
ccgggttatgacgtaaccgaattactcgcaaagcatgactatgacgaactcaaaatggta
aaaggagctgaaagcttttttacctcaatgggctttgatgcattgccaactacattttac
gaacgctcactgtttatcaaaccaaaagatagagatgtgcaatgccatgcatcagcatgg
aacatcgacagtaaagacgatttgcgtattaaaatgtgtattcagcgcacaggcgaagag
ttttcggttattcatcatgagttaggtcataacttttatcagcgtgcgtacaacaaacag
cctttattttaccaagaaagtgctaacgatggttttcatgaggccattggcgataccatt
gccttatctgttacgcctggatatttaaatgaaattggtttgcttgaacaagtcccagat
gaatcaaaagacatcggtttactaatgaaaatggcactcgataaagttgcctttgtaccc
tttagcctaatggttgatcagtggcgctggcaggtattttcaggtgaagtaacacctgag
aactacaataaagcatggtgggaactgcgtgaaaaataccaaggtgtacaagcccctatt
gcacgtagcgaaaacgactttgatccgggtgctaagtaccacgttccaggtaatacgcct
tacactcgttattttctagcgcatattttacaatttgagtttcatcgcagtttatgtgaa
attgccggtaacgataaagcgattcatcgctgctctatttacaactcaaaagaagcaggg
gataagctaaatgctatgcttgaaatgggttcttctcgaccttggcaagaagcgcttgaa
accataacaggtaaaccacagatggatgcaactgcaatgctcgattactttgcgccatta
caaacatacttagataagcaaaatgaaggccgcaactgcggctggtaa

DBGET integrated database retrieval system