KEGG   Pantoea ananatis LMG 20103: PANA_3696Help
Entry
PANA_3696         CDS       T01195                                 

Gene name
glpD
Definition
(GenBank) GlpD
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pam  Pantoea ananatis LMG 20103
Pathway
pam00564  Glycerophospholipid metabolism
pam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pam00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PANA_3696 (glpD)
Enzymes [BR:pam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     PANA_3696 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 3HCDH_N Lycopene_cycl FAD_oxidored GIDA
Motif
Other DBs
NCBI-ProteinID: ADD78863
UniProt: D4GD38
LinkDB All DBs
Position
4085902..4087407
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEARDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRTGLFMYDHLGKRTSLPGS
KSLSFGAESALKPEIKRGFEYSDCWVDDARMVVLNAQEVVKHGGEVRTRTRVTRAWRENG
LWMVEAEDIDSGKTFTWQAKGLVNAAGPWVKQFFDDGLELKSPYGIRLIKGSHIVVPRVH
NEKQAYILQNEDNRIVFVIPWMDEFSIIGTTDVEYKGDPKSVAIDDNEIDYILKVYNGHF
KKQLTPDDIVWTYSGVRPLCDDESDSPQAITRDYTLDVRDDNGQTPLLSVFGGKLTTYRK
LAEHALEKLSKYYPDAGAAWTKNCVLPGGNISGSSDDYAASLRRRYPFITENMARHYART
YGSSTEVLLKDATSLEDLGENFGHEFYEAELRYLVQHEWVREVDDAIWRRTKQGMWLNES
QQARIAEWLAAKAKPTLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccaaagacctgatcgttatcggcggcggcatcaacggtgctggcatcgcagca
gacgctgcaggacgcggactgtcggtgttaatgctagaggcgcgggacctggcttgcgcg
acctcttccgccagctcaaagctgattcacggtggcctgcgctaccttgaacattatgaa
ttccgtctggtgagcgaagcgctggccgaacgcgaagtgctgttaaagatggcaccccat
atcgcgttcccaatgcgctttcgcttaccacaccgcccgcatctgcgtccggcgtggatg
atccgtaccggcctgtttatgtacgatcacctgggcaagcgcacgagtctgccgggcagt
aaaagcctgagctttggtgcagagtctgcacttaagcctgaaattaagcgcggttttgag
tattccgactgctgggtggacgatgcccgaatggtggtactcaatgcgcaggaagtggtt
aaacatggtggtgaggtgcgtacccgcactcgcgtgactcgcgcatggcgtgagaacggc
ctgtggatggtagaagctgaggatatcgacagcggcaaaaccttcacctggcaggccaaa
ggcctggtcaacgccgccggtccatgggttaagcagttcttcgacgatggcctggagctg
aaatcgccttacggtattcgcctgatcaaaggcagccatattgtggtgccgcgcgttcac
aatgagaagcaggcttatatcctgcaaaacgaagataaccgtattgtgtttgtcattccg
tggatggatgagttttctatcatcggcaccacagacgtggaatacaaaggcgatccgaaa
agcgtcgctattgatgataatgaaatcgactacatcctgaaggtgtacaacggccatttc
aaaaagcagctgacgcctgacgacattgtgtggacctattccggcgtgcgtccgctttgt
gatgacgagtccgattcgccgcaggcgatcactcgcgattacaccctggatgtccgcgat
gacaacggtcagacgccgctgctgtccgttttcggcggtaaattaacgacttaccgtaaa
ctggccgagcatgcgctggagaagctgtcgaagtattatcctgatgcgggcgcagcatgg
actaaaaactgcgtgctgcccggcggtaatatttccggcagcagcgacgattacgctgcc
agcctgcgccgccgttacccgttcattactgaaaacatggcacgtcactacgcccgcact
tacggtagcagcaccgaagtgctgcttaaagacgcgacatcgctggaagacctgggtgaa
aacttcggtcatgagttttatgaggcggagttacgttaccttgtgcagcatgagtgggtg
cgtgaagtggatgatgctatctggcgccgtaccaagcaaggtatgtggctgaacgaatcc
cagcaggcacgcattgccgaatggctggcggctaaggcgaagcctacgctgtcgctggca
tcgtag

DBGET integrated database retrieval system