KEGG   Pantoea sp. PSNIH1: PSNIH1_15000Help
Entry
PSNIH1_15000      CDS       T03464                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pant  Pantoea sp. PSNIH1
Pathway
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pant00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PSNIH1_15000
   00790 Folate biosynthesis
    PSNIH1_15000
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSNIH1_15000
Enzymes [BR:pant01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PSNIH1_15000
Exosome [BR:pant04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSNIH1_15000
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:pant00537]
 Enzymes
  PSNIH1_15000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3149563..3150969)
Genome map
AA seq 468 aa AA seqDB search
MKHLPLLTVSLLASLIATSAVADVTTYNRAATGDLTQHGGARRLSSDQTEALKASLSNQT
AKNVILLIGDGMGDSEITAARNLAVGAGGFFAGIDALPLTGQYTHYSLDKKTHKPSYVTD
SAASATAWATGTKSYNGAIGVDVNGKDQITLLELAKAAGKATGNVSTAELQDATPAALMA
HVTSRKCYGPEKTSELCPGNALEQGGRGSITEQMLLTRPDVVLGGGAKSFNEVAKAGDYK
GKTLYEQAQARGYQLVENLDAMNAVQQATQQQPLLGLFAPGNMPVRWQGPKASYHGNIDK
PVVTCKVNQDRPASVPTLAQMTTKAIDLLSKNEKGFFLQVEGASIDKQDHAANPCGQIGE
TVDLDEAVQVALAYAREHGDTLVVVTADHAHSSQIVENGTKAPGLTQALNTKDGAVMTIS
YGNSEEDSQEHTGAQLRIAAYGPHAANVVGLTDQTDLFFTLKNALALK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacttacctctgctgacggtttcactgctggcttcgctgattgccacctccgcg
gtggcagatgttacaacatacaatagagcagcaactggcgatttgacgcagcatggtggc
gcgcgtcggctgagcagcgatcagactgaggcgctgaaagcctcgctgagtaatcagacg
gcgaaaaatgtcattttactgatcggcgacggcatgggtgactctgagatcaccgcggca
cgtaaccttgcagtgggagcgggcggcttttttgccggtattgatgcgcttccgcttacc
gggcagtacacgcactattcgctggataaaaaaacgcataaaccctcttacgtcactgac
tctgccgcgtccgccaccgcgtgggctacaggcaccaaatcctataacggggcgattggc
gtcgacgtcaatggcaaggatcaaatcacgctgcttgagctggctaaagcggccggcaaa
gcaacgggtaatgtctctactgccgaactgcaggatgctacgccagcggcactgatggcg
catgttacctcacgcaaatgctacggcccggagaaaaccagcgaactctgcccgggcaac
gccttagagcagggcggccgcggctcaattaccgagcaaatgctgctgacccggccggat
gtggtcctgggcggcggtgcaaagagctttaacgaggtggctaaagcaggcgactataaa
ggcaaaacgctgtatgagcaggcgcaggcgcgcggctatcagctggtagaaaacctggac
gcaatgaacgcggtacagcaggccacccagcagcagcctctgctggggctgtttgcgccg
ggcaatatgccggtgcgctggcagggtcccaaagccagttatcatggcaacatcgataaa
ccggtggtgacctgtaaggttaatcaggatcgtccggcatcggtgccgacgctggcgcag
atgacaacaaaagcgatcgacctgctgagcaaaaatgagaaagggttcttcctgcaggtc
gagggcgcttcaatcgataaacaggatcacgcggctaatccgtgcggccagattggcgaa
acggtcgatctcgacgaagcggtccaggtggcgctggcctatgcccgcgaacatggcgat
acgctggtggtggtcaccgccgaccacgcgcacagcagtcagattgttgagaacggcacc
aaagccccgggcctgacccaggcgctgaacacgaaagatggtgcggtaatgaccatcagc
tacggcaactcggaagaggattcgcaggagcataccggtgctcagctgcgcattgctgct
tacggaccgcacgcggcaaacgtggtggggctgaccgatcagaccgatctgttcttcaca
ctaaaaaatgcgctggcgcttaaataa

DBGET integrated database retrieval system