Papio anubis (olive baboon): 101013677 Help Entry 101013677         CDS       T07474                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism panu  Papio anubis (olive baboon) Pathway panu04613   Neutrophil extracellular trap formation panu05034   Alcoholism panu05202   Transcriptional misregulation in cancer panu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:panu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101013677  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101013677   09163 Immune disease    05322 Systemic lupus erythematosus     101013677   09165 Substance dependence    05034 Alcoholism     101013677  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:panu03036]     101013677   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:panu04147]     101013677 Chromosome and associated proteins [BR:panu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101013677 Exosome [BR:panu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101013677 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  101013677 NCBI-ProteinID:  XP_003897202 Ensembl:  ENSPANG00000032166 UniProt:  A0A096MPD3 LinkDB All DBs Position 6:26039854..26041037 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtactaagcaaactgctcggaagtctactggtggcaaggcgccacgcaaacag ttggccactaaggcagcccgcaagagtgctccggccaccggcggtgtgaaaaaaccccac cgttaccggcccggtactgtggctctgcgcgagatccgccgttatcagaagtccaccgaa ctgctgattcgtaaactacctttccagcgcctagtgcgcgagattgcgcaggactttaaa acagacctgcgcttccagagctctgctgtgatggctctgcaggaggcgtgcgaggcctac ttagttgggctgtttgaggacactaacctgtgcgccatccacgccaagcgtgtcactatc atgcccaaggacatccagctcgctcgccgcatccgcggagagcgggcatga

DBGET integrated database retrieval system