Papio anubis (olive baboon): 103875593 Help Entry 103875593         CDS       T07474                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism panu  Papio anubis (olive baboon) Pathway panu04613   Neutrophil extracellular trap formation panu05034   Alcoholism panu05203   Viral carcinogenesis panu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:panu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103875593  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     103875593   09163 Immune disease    05322 Systemic lupus erythematosus     103875593   09165 Substance dependence    05034 Alcoholism     103875593  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:panu03036]     103875593 Chromosome and associated proteins [BR:panu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103875593 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  103875593 NCBI-ProteinID:  XP_031513296 Ensembl:  ENSPANG00000033703 LinkDB All DBs Position 1:complement(120330129..120331255) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctggcaggggaaagggtggaaaaggcttaggcaaagggggcgctaagcgccaccgc aaggtcctgagagacaacattcagggcatcaccaagcctgccattcggcgtctagctcgg cgtggcggcgttaagcggatctctggcctcatttacgaggagacccgcggtgtgctgaag gtgttcctggagaacgtgattcgggacgcagtcacctacaccgagcacgccaagcgcaag accgtcacagccatggatgtggtgtacgcgctcaagcgccaggggcgcacactgtacggc ttcggaggctag

DBGET integrated database retrieval system