KEGG   Pantoea sp. At-9b: Pat9b_3856Help
Entry
Pat9b_3856        CDS       T01386                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pao  Pantoea sp. At-9b
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pat9b_3856
  Energy metabolism
   00680 Methane metabolism
    Pat9b_3856
Enzymes [BR:pao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Pat9b_3856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
4213116..4215767
Genome map
AA seq 883 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKDALGENILDKVETIRKLSKSSRAGNDTHRKELLSTL
QNLSNDELLPVARAFSQFLNLTNVAEQYQTIARSGEGANHPELLKSTFDRLKQQKDLNES
DIRAAIESLSLELVLTAHPTEITRRTLIHKLVEVNSCLQQLDHSDITEYEYNQVMRRLRQ
LVAQAWHTDEIRKYRPTPVDEAKWGFAVVENSLWEGVPAFLRELNEQVEETFGMRLPVDF
VPVQFTSWMGGDRDGNPNVTASITRQAMQLGRWKAADLFLRDVGVLISELSMSECSDEVR
ELCGDPEALEPYRVILKRIRSQLMSTQAFLERRLKGERLPRPADLLVSNDQLWQPLFAIY
QSLQQCGMGIIANGQLLDTLRRVKCFGVPLVRIDLRQESTRHTEAIAEVTRYLGLGDYES
WSEADKQAFLIRELNSKRPLLPRQWEPSDNTREVLDTCKVAAEAPQGSIAAYVISMAKVP
SDVLAVHLLLKEAGITYAMPVAPLFETLDDLNNANDVMSQLLGIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIALTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTIASLSLYTGAILEANLMPPPEPKSEWCDIMDGL
SAHSCAMYRGYVRENPDFVPYFRSATPEQELGKLPLGSRPAKRRATGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAAIQKAMEQGHQDQLETMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVDKSLWPLGQQLRDQLDADIKAVLTIANDAHLMADQPWIAESIALRNVYTDPLN
VLQAELLHRSRAQEERGDEPDARVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagtaatgtcagtatgctcggcaaactgctcggg
gatacgataaaggatgcactgggagagaacatcctcgataaggtggagaccatccgcaaa
ctctctaagtcatcccgtgccggaaatgacactcatcgtaaggaactgctgtcgacgctg
caaaacctgtccaatgacgagttgctgccggtcgcacgtgcattcagtcagttcctgaat
cttaccaacgtggcagaacagtatcagaccattgcgcgcagcggcgaaggtgctaaccac
ccggagctgctgaaaagcaccttcgatcgcctgaagcagcagaaagatctgaatgaaagc
gatatccgtgcggcgattgaatcgctgtcgctggaactggtgctgacggcgcacccgact
gagattacccgtcggaccctgattcacaaactggtcgaggtgaacagctgtctgcaacag
ctcgaccatagcgatatcaccgaatatgaatacaaccaggtgatgcgtcgtctgcgccag
ctggttgctcaggcctggcacaccgatgaaattcgtaaatatcgtccgaccccggtcgat
gaagccaaatggggctttgcggtggtagaaaacagcctgtgggaaggcgtaccggcgttc
ctgcgtgagctgaatgagcaggtcgaagagacctttggtatgcgactgccggtggatttt
gtcccggtgcagtttacctcctggatgggcggtgaccgcgacggcaacccgaacgtcacc
gccagcatcacgcgccaggcgatgcaactgggccgctggaaagccgccgacctgttcctg
cgcgatgtcggcgtgctgatatctgagctgtcgatgtccgagtgcagcgacgaagtacgt
gaactctgtggtgacccggaagcgctggaaccttaccgcgtgattctgaaacgtatccgc
agccagttgatgagcacccaggctttcctggaacgtcgtctaaagggcgagcgtttaccg
cgtccggcggatctgctggtatccaacgaccaactgtggcaaccgctgtttgccatctac
cagtcactgcaacaatgcggcatgggtatcatcgccaatggtcagctgctggatacgctg
cgtcgcgtgaagtgttttggtgtaccgctggtgcgtatcgacctgcgtcaggaaagtacc
cgccacactgaagcgattgccgaagtgacgcgctatcttggcctcggtgattatgaaagc
tggtcagaagccgacaaacaggcgttcctgatccgtgaactgaactccaaacgtccgcta
ctgccacgccagtgggagccgagcgacaatacccgcgaagtgctggatacctgtaaagtg
gccgccgaagcgccacaaggttcgattgccgcttatgtcatctccatggcaaaagtgcca
tccgatgtgctggccgtccacctgctgctgaaagaagccggtatcacctacgccatgccg
gtggcaccgctgtttgaaaccctcgacgacctgaacaacgccaacgacgtcatgagccaa
ctactgggcatcgactggtatcgcggctttattcagggcaagcagatggtgatgattggc
tattctgactctgcgaaagatgctggtgtgatggcggcaagctgggcgcaatatcaggcg
caggacgcattgatcaagacctgtgaaaaagccggtattgccctgacgctgttccatggc
cgtggcggctcgattggccgtggtggtgcaccggcgcacgcagcgctgctgtcacaaccg
ccgggaagcctgaaaggcggcctgcgcgtgacggaacagggtgagatgattcgcttcaaa
tacggcttgccggaagtgactatcgccagtctgtcgctgtacaccggggcgattctcgaa
gccaacctgatgccaccgccggagccgaaaagcgaatggtgcgacatcatggacggtctg
tcggcccactcctgtgcgatgtatcgcggctatgtgcgtgaaaatcctgatttcgtgccg
tatttccgctctgcaacgccggaacaggaactgggcaaactgccactgggttcacgcccg
gccaaacgccgtgctaccggtggtgtggagtcactgcgcgcgattccgtggatttttgcc
tggacgcagaaccgtctgatgctgcctgcctggctgggtgccggtgcggccatccagaaa
gccatggaacaaggtcatcaggatcaactggaaacaatgtgccgcgactggccattcttc
tcgacccgtcttggcatgctggaaatggtgttctcgaaagctgacctgtggctggcggaa
tactacgatcagcgcctggtggataaatctctgtggccgctgggccagcaattgcgtgat
cagctggacgcggatatcaaagccgtgctgaccatcgccaacgatgcgcatctgatggcg
gatcagccgtggattgccgaatccatcgcactgcgtaacgtctacactgacccgctgaac
gtgttgcaggctgaattgctgcatcgttcacgtgcgcaggaagaacgtggtgatgaaccg
gatgcgcgcgtagaacaggcgctgatggtgaccatcgccggtgtcgcagcgggtatgcgt
aataccggctaa

DBGET integrated database retrieval system