KEGG   Pantoea ananatis PA13: PAGR_g1624Help
Entry
PAGR_g1624        CDS       T01970                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase GabT
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
paq  Pantoea ananatis PA13
Pathway
paq00250  Alanine, aspartate and glutamate metabolism
paq00280  Valine, leucine and isoleucine degradation
paq00410  beta-Alanine metabolism
paq00640  Propanoate metabolism
paq00650  Butanoate metabolism
paq01100  Metabolic pathways
paq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PAGR_g1624
   00650 Butanoate metabolism
    PAGR_g1624
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAGR_g1624
   00280 Valine, leucine and isoleucine degradation
    PAGR_g1624
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PAGR_g1624
Enzymes [BR:paq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     PAGR_g1624
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     PAGR_g1624
Amino acid related enzymes [BR:paq01007]
 Aminotransferase (transaminase)
  Class III
   PAGR_g1624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AER32147
LinkDB All DBs
Position
1782719..1784035
Genome map
AA seq 438 aa AA seqDB search
MQNVLAEQQTYADNSQLLDVRDHNVPRGIITAHPLVIERAKGSEVWDVEGNRYLDFVGGI
GVLNVGHNHPAVVNAVTRQLGMVSHACFQVAAYPGYIELAQRLNKLVGGDEHYKSVFFTS
GAEAVENAVKIARSYTQRPGIIAFDGAFHGRTLLGVTLTGMSAPYKQNFGPFPGDVYRLP
FPNPLHGVTEADCLKALDQLFSVQILPERVAAIIIEPVQGDGGFLPAGPAFMQALRRITT
QHGIMLICDEIQSGFGRTGTMFAFQQLGIKPDMITTAKSLAGGLPISGVVGKAEIMDSPA
PGGLGGTYGGNALACAAALAVLDIFEQENLLARSCQLGEQLNQRLRQLADKYACIGDVRG
VGFMQAVEILDVDTHKPDSALTQKILDSACQEGLLLIKCGLHRNTIRFLAPLVTTDSQLE
EALHIFDIALARATGRLG
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgtcctggcagagcagcaaacctatgcggacaacagccagttgctggatgtc
cgagatcacaatgtgccgcgtggcattattaccgctcatccgctggtgattgagcgagcc
aaaggcagcgaagtatgggatgtggaaggcaaccgctatctggattttgtgggcggtatt
ggcgtccttaacgtaggccacaaccatccggccgtggttaacgccgtcacccgccaactg
ggcatggtgtcccatgcctgttttcaggtggcggcctatccgggatacattgagctggcc
cagcgtctgaataagctggtgggcggtgacgagcactataaaagcgtgtttttcaccagc
ggtgcagaagcggtagagaacgcggtgaaaatcgcccgttcttatacgcaacggccgggc
atcattgcgtttgacggggctttccacggacgtaccctgcttggcgtgacgctgacgggc
atgtctgcgccatacaaacagaattttggtccgttcccgggggatgtttatcgcctgccg
ttcccgaatccgttgcacggtgtgactgaggccgactgtctgaaggcacttgatcagctg
ttttctgtgcagattttgccggagcgcgtcgccgcgattatcattgaacccgttcagggc
gatggcggcttcttacctgcaggcccggcatttatgcaggcgctgcgtcgtattactacc
cagcacggcattatgctgatctgtgatgaaattcagagcggctttggccgtaccggtacc
atgtttgccttccagcaactcggcatcaaacccgacatgatcaccacggcgaagagcctg
gccggtggcttgccgatttccggcgtggtgggcaaagccgagatcatggacagtccggcc
ccgggcgggttgggcggcacctatggtggtaatgcgctggcctgtgcggcggcactggct
gtactggatatcttcgagcaggaaaacctgctggcgcgctcctgccagttgggcgagcag
ttaaaccagcgtctgcgccagcttgcggataaatatgcctgcatcggcgatgtacgcggc
gtgggctttatgcaggcagtagaaattctggatgtggatacccataaacccgacagcgcg
ctgacacaaaagatcctcgacagcgcctgtcaggaaggcctgctgctgatcaaatgtggt
ttgcatcgcaacaccatccgcttccttgcaccgttagtgaccaccgattcgcaactcgaa
gaagcgctgcatatctttgatattgcgctggcgcgtgcgaccggacgcttaggttag

DBGET integrated database retrieval system