KEGG   Paraburkholderia sp. SOS3: BTO02_03915Help
Entry
BTO02_03915       CDS       T04966                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
para  Paraburkholderia sp. SOS3
Brite
Enzymes [BR:para01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BTO02_03915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:858510..859088
Genome map
AA seq 192 aa AA seqDB search
MEHQLPPLPFAKNALAPHMSEETLEFHYGKHHQTYVTNLNNLIKGTEYENLTLEEIVKKS
SGGVFNNSAQVWNHTFFWNSLKPQGGGQPSGALAEAINKKWGSFDKFKEEFTKTAVGTFG
SGWAWLVKKPDGSLDLVSTSNAATPLTTDAKPLLTIDVWEHAYYIDYRNARPKFVEAYWN
IVNWDFAAKNFG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggaacatcagctcccgcctctgccgttcgcgaaaaacgcactcgcgccgcacatgtcc
gaagagacgctcgagtttcattacggcaagcatcaccagacctatgtgactaacctgaat
aatctgatcaagggtaccgagtacgaaaatctgacgcttgaagaaatcgtcaagaaatcg
tcgggcggcgtgttcaacaattccgcccaggtgtggaatcacacgttcttctggaatagc
ctgaagccgcaaggcggcggccagccgagcggcgcgcttgcagaagcgatcaacaagaag
tggggttccttcgacaagttcaaggaagagttcacgaagacggcagtcggcacgttcggc
tcgggctgggcctggctcgtgaagaagcccgacggctcgctcgatctcgtttcgacgagc
aatgccgccacgccgctcaccaccgatgcgaagccgctgctcacgatcgacgtgtgggag
cacgcgtactacatcgactatcgcaacgcgcgtccgaagttcgtcgaggcgtactggaac
atcgtgaactgggacttcgcagcgaagaacttcggctga

DBGET integrated database retrieval system