KEGG   Paraburkholderia sp. SOS3: BTO02_26935Help
Entry
BTO02_26935       CDS       T04966                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
para  Paraburkholderia sp. SOS3
Pathway
para03030  DNA replication
para03410  Base excision repair
para03420  Nucleotide excision repair
para03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:para00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BTO02_26935
   03410 Base excision repair
    BTO02_26935
   03420 Nucleotide excision repair
    BTO02_26935
   03430 Mismatch repair
    BTO02_26935
Enzymes [BR:para01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BTO02_26935
    6.5.1.6  DNA ligase (ATP or NAD+)
     BTO02_26935
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BTO02_26935
DNA replication proteins [BR:para03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BTO02_26935
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BTO02_26935
DNA repair and recombination proteins [BR:para03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BTO02_26935
   NER (nucleotide excision repair)
    Other NER factors
     BTO02_26935
   MMR (mismatch exicision repair)
    Other MMR factors
     BTO02_26935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_gyraseA_C
Motif
Other DBs
NCBI-ProteinID: APR39003
UniProt: A0A1L6I5I8
LinkDB All DBs
Position
2:complement(1542435..1544147)
Genome map
AA seq 570 aa AA seqDB search
MKRFAALYAALDATTSTRDKLDALTTYFSAAPPEDAAWASYFLAGGKPRQTVPTRLLTEI
ARERAGLPAWLFDESYQAVGDLAETIAHVLPPAARASELGLTQWVEERVLTLRGTSPERL
RTRLVEYWDELDWSGRFLLTKLIGGGFRVGVARQLVVRALADVAGVDHKLIAQRMVGWTD
ARQPPDAARYLRLIAPAASSSPPDAQRADLRGSAGAAASETAHEAERALPYPFFLAHPLQ
AAPETLGNPANWLVEWKWDGIRAQIVKRDGRVWIWSRGEDLITERFPEVVALGEALPDGH
VIDGEILAWQPGAQAPLPFARLQPRITRKSLTKKVLADSPAAFLAYDLLEAHGTDLRMTP
LAARRARLDALADSRTDTLARDLLRVSPLVDADSWSAMAELREQSRARGVEGLMLKERQS
LYGVGRTKAAGTWWKWKIDPYTIDAVLVYAQRGHGRRASLYTDFTFAVWDEANGIRTLVP
FAKAYSGLTDEEMREVDAIVRKTTVEKFGPVRSVTPTLVFEIGFEGIQASTRHKSGVAVR
FPRMLRRRSDKHIDDADTLAMLKGFIDPTA
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgctttgccgcgctctatgcggcgctcgacgcgaccacatcgacccgcgacaaa
ctcgatgcgctcacaacctatttttcggcagcgccgccggaagatgccgcatgggcgtcg
tatttcctcgccggcggcaagccgcggcagacggtgccgacacgtctactgaccgagatc
gcacgcgaacgcgcgggcttgcccgcatggctcttcgacgagtcgtaccaggccgtcggc
gatctcgccgaaaccattgcgcatgtgctgccgcccgccgctcgcgcatcggagctcggg
ctcacacaatgggtcgaggaacgcgtgctgacactgcgcggcacatcgcccgagaggttg
cgtacccggctcgtcgagtattgggacgagctcgactggagcggccgcttcctgctgacg
aagctgattggcggcggatttcgcgtcggcgtcgcgcggcagctcgtcgtgcgcgcgctc
gccgacgtggccggtgtcgaccacaagttgatcgcgcaacgaatggtcggctggaccgac
gcgcggcagccgcccgacgcggcgcgctacctgcgcctgatcgcaccggctgcatcgtct
tcgccgcccgacgcgcagcgtgcggacctgcggggtagcgccggcgcggcggcctccgaa
actgcgcacgaagccgagcgcgcgctgccctacccgttctttctcgctcatccattacag
gccgcgcccgaaacgctcggcaaccccgcgaactggctcgtcgaatggaagtgggacggc
atacgcgcccagatcgtcaaacgcgacggccgcgtatggatctggtcgcgcggcgaggat
ctgatcaccgagcgctttcccgaagtggtcgcgcttggcgaggcgctaccggacgggcac
gtgatcgacggcgaaatactcgcgtggcagccgggcgcgcaagcgccgctgccgttcgcg
cgcctgcagccgcgcatcacacgcaaatcgctgacaaagaaggtgctcgccgactcgccc
gccgcgtttcttgcctacgacctgctcgaagcgcacggcaccgatctgcgcatgacgccg
ctcgccgcacggcgcgcgaggctcgatgcattggccgattcgcgtaccgacacgctcgca
cgcgatctgctgcgcgtctcgccgctcgtcgatgccgacagctggtccgcaatggcagag
ttgcgcgaacagagccgcgcgcgcggcgttgaaggtttgatgctcaaggagcggcaatcg
ctttacggcgtgggccgcacgaaggctgcgggcacatggtggaaatggaaaatcgatcct
tatacgatcgatgccgtgctcgtctatgcgcaacgcggacacggccgccgcgcgagtctg
tatacggatttcacgttcgcagtgtgggacgaagcgaatggcatacgtacgttggttccg
tttgccaaagcgtactcgggcctgaccgacgaagaaatgcgcgaggtcgacgcaatcgtg
cgcaaaaccacggtcgagaaatttggaccggtgcgcagcgtcacgccgacgctcgtcttc
gaaatcggcttcgaaggcatccaggcaagcacgcgccataaatcgggcgtcgccgtgaga
tttccgcgcatgctacgcaggcgttcggataagcatatcgacgatgcggacacgttagcg
atgctcaaaggcttcatcgacccgacagcgtaa

DBGET integrated database retrieval system