KEGG   Pectobacterium atrosepticum 21A: GZ59_25470Help
Entry
GZ59_25470        CDS       T03293                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
pato  Pectobacterium atrosepticum 21A
Pathway
pato00250  Alanine, aspartate and glutamate metabolism
pato00410  beta-Alanine metabolism
pato00640  Propanoate metabolism
pato00650  Butanoate metabolism
pato01100  Metabolic pathways
pato01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pato00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    GZ59_25470 (gabT)
   00650 Butanoate metabolism
    GZ59_25470 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GZ59_25470 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GZ59_25470 (gabT)
Enzymes [BR:pato01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     GZ59_25470 (gabT)
Amino acid related enzymes [BR:pato01007]
 Aminotransferase (transaminase)
  Class III
   GZ59_25470 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AIK14342
LinkDB All DBs
Position
complement(2776651..2777916)
Genome map
AA seq 421 aa AA seqDB search
MKNSELNQRRLAATPRGVGVMCDFYAERAENSTLWDVEGREFIDFAAGIAVLNTGHRHPK
IVAAVREQLDRFTHTAYQIVPYGSYVTLAERINALAPIQGAAKTTFFTTGAEAVENAVKI
ARAYTKRPGVIAFNAAFHGRTLLTMTLTGKVAPYSTGFGPFPGSIFHALYPNEQTGITVE
QALESVERLMHTDIAADQVAAIILEPVQGEGGFHVAPPAFISGLRKLCDEHGILLIADEV
QTGFARTGKLFAMEYYTEKADLITMAKSLGGGFPISGVVGRAEVMDAPSPGGLGGTYAGN
PLSVASALAVLDVIEEEKLCQRAQRLGAALVETLEKVKAQCPALVAIRAQGSMVAAEFND
PNTGKPSAEITRQFQKSALEAGLLLLTCGVHGNVIRFLYPLTVPDEQFSKAMNILTRVLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatagcgaactgaatcaacgccgtctggccgccacaccgcgtggtgtaggtgtc
atgtgtgatttctatgctgagagagcggaaaacagcaccctgtgggatgttgaaggacgc
gagtttatcgatttcgccgccgggattgcggtgctgaataccggccatcgccacccgaaa
attgtcgctgcggtgcgcgaacaactggatcgctttacccatacggcctatcaaattgtg
ccttacggtagctatgtcacgttggccgagcgtattaatgcgttggcaccgattcaaggc
gcggcaaaaaccacgttctttaccaccggagcagaagcggtggaaaacgcggtgaaaatc
gcccgtgcttacaccaagcgtcctggcgtgattgctttcaacgcggcgtttcatggtcgt
acactgctgaccatgacgctgacgggcaaagtagcaccgtactccacggggtttggcccg
ttccccggttccatttttcacgcgctttatccgaatgaacaaaccggtattaccgttgaa
caggcactggaaagcgtcgaacgtctgatgcataccgatatcgccgccgatcaggttgct
gcgattattctggaaccggtacagggtgaaggcggttttcatgttgcgccgcccgctttt
atcagcgggctgcgtaagctgtgcgatgagcatggcatcctgctgattgccgatgaagtg
cagacgggctttgcgcgtaccggtaagctgtttgcgatggagtattacacggagaaagcg
gatctgatcaccatggcgaaaagcctgggcggtggtttcccgatctctggcgtggtcggc
cgtgctgaggtgatggatgcgccatcgccgggcgggctgggcggcacctatgcgggtaac
ccgctgtcggtcgcttcggcgctggcggtattggatgtgattgaagaagaaaaattgtgc
caacgtgcgcagcgtctgggtgctgcactggtagaaacgctggagaaagtaaaagcgcag
tgtccagcactggtagcgattcgtgcgcaagggtcgatggtcgcggctgaatttaacgat
ccgaacacgggtaaaccctcggcagagattacccgccaatttcagaaaagcgcattagag
gcgggcttgctgctgctgacctgcggtgtgcatggcaacgtgattcgtttcctgtatccg
ctgacggttcctgatgagcagttcagcaaagcgatgaacatcctgacgcgcgtattaaca
cgatag

DBGET integrated database retrieval system