KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_08680Help
Entry
PA14_08680        CDS       T00401                                 

Gene name
tufB
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Brite
Translation factors [BR:pau03012]
 Eukaryotic Type
  Elongation factors
   PA14_08680 (tufB)
 Prokaryotic Type
   PA14_08680 (tufB)
Mitochondrial biogenesis [BR:pau03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PA14_08680 (tufB)
Exosome [BR:pau04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PA14_08680 (tufB)
  Exosomal proteins of breast cancer cells
   PA14_08680 (tufB)
  Exosomal proteins of colorectal cancer cells
   PA14_08680 (tufB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
741311..742504
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTKVCSDTWGGSARAFDQIDNAPEEKARG
ITINTSHVEYDSAVRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLNTYDFPGDDTPIIIGSALMALE
GKDDNGIGVSAVQKLVETLDSYIPEPVRAIDQPFLMPIEDVFSISGRGTVVTGRVERGII
KVQEEVEIVGIKATTKTTCTGVEMFRKLLDEGRAGENVGILLRGTKREDVERGQVLAKPG
TIKPHTKFECEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
KMVVTLIAPIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaatttgaacggaacaagccgcacgtcaacgtcggcaccatcggtcac
gttgaccatggcaagaccactctgaccgctgcactgaccaaggtctgctccgacacctgg
ggtggttctgctcgtgctttcgatcagatcgacaacgcgccggaagaaaaggcccgcggt
atcaccatcaacacctcgcacgttgaatacgattccgctgttcgtcactacgctcacgtt
gactgccccggtcacgccgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggctgccgacggccccatgccgcagacccgcgagcacatc
ctgctgtcccgccaggtaggcgttccctacatcgtcgtgttcctgaacaaggctgacatg
gtcgacgacgccgagctgctggaactggtcgagatggaagttcgcgatctgctgaacacc
tacgacttcccgggcgacgacactccgatcatcatcggttccgcgctgatggcgctggaa
ggtaaagatgacaacggcatcggcgtaagcgccgtgcagaagctggtagagaccctggac
tcctacattccggagccggttcgtgccatcgaccagccgttcctgatgccgatcgaagac
gtgttctcgatctccggccgcggtaccgtggtaaccggtcgtgtagagcgcggcatcatc
aaggtccaggaagaggtggaaatcgtcggcatcaaggcgaccaccaagaccacctgcacc
ggcgttgaaatgttccgcaagctgctcgacgaaggtcgtgctggtgagaacgttggtatc
ctgctgcgtggcaccaagcgtgaagacgtagagcgtggccaggtactggccaagccgggc
accatcaagccgcacaccaagttcgagtgcgaagtgtacgtgctgtccaaggaagaaggt
ggtcgtcacactccgttcttcaagggctaccgtccgcagttctacttccgtaccaccgac
gtgaccggtaactgcgagctgccggaaggcgtagagatggtaatgccgggcgacaacatc
aagatggttgtcaccctgatcgctccgatcgccatggaagatggcctgcgcttcgcgatc
cgcgaaggcggccgtaccgttggtgccggcgtggttgccaagatcatcgaataa

DBGET integrated database retrieval system