KEGG   Pseudomonas aeruginosa UCBPP-PA14: PA14_36910Help
Entry
PA14_36910        CDS       T00401                                 

Definition
(GenBank) putative ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pau  Pseudomonas aeruginosa UCBPP-PA14
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pau00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    PA14_36910
Enzymes [BR:pau01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PA14_36910
DNA repair and recombination proteins [BR:pau03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PA14_36910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(3287787..3290309)
Genome map
AA seq 840 aa AA seqDB search
MPSSKPLAEYARKRDFRQTPEPSGRKPRKDSTGLLRYCVQKHDASRLHYDFRLELDGTLK
SWAVPKGPCLDPAVKRLAVQVEDHPLDYADFEGSIPQGHYGAGDVIVWDRGAWTPLDDPR
EGLEKGHLSFALDGEKLSGRWHLIRTNLRGKQPQWFLVKAKDGEARSLDCFDVLKERPDS
VLSERTLLPRHGEAATPAARPARRGKSGGKTPMPEWIAPELASLVEQPPRGEWAYELKLD
GYRLMSRIEDGHVRLLTRNGHDWTERLPHLEKALAGLGLQRSWLDGELVVLDEEGRPDFQ
ALQNAFEEGRGENILYVLFDLPYHEGEDLRDVALEERRARLEALLEGRDEDPLRFSATLA
EDPRDLLASACKLGLEGVIGKRLGSAYRSRRSNDWIKLKCQLRQEFVIVGYTEPKGSRRH
IGALLLGLYSPDEERRLRYAGKVGSGFTAASLKKVRERLEPLAVRSSPLAKVPPARETGS
VQWVRPQQLCEVSYAQMTRGGIIRQAVFHGLREDKPAREVTGERPAGPPPLRGARKAGAG
ASRAATAGVRISHPQRLIDPSIQASKLELAEFHARYADLLLRDLRERPVSLVRGPDGIGG
ELFFQKHAARLKIPGIVQLDPALDPGHPPLLQIRSAEALVGAVQMGSIEFHTWNASLANL
ERPDRFVLDLDPDPALPWKRMLEATQLSLTLLDELGLRAFLKTSGGKGMHLLVPLERRHG
WDEVKDFAQAISQHLARLMPERFSAVSGPRNRVGKIFVDYLRNSRGASTVAAYSVRAREG
LPVSVPVFREELDSLQGANQWNLRSLPQRLDELAGDDPWADYAGTRQRISAAMRRQLGRG
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atgcccagcagcaagccgctcgccgagtacgcccgcaagcgcgatttccgccagaccccg
gagcccagcggccgcaagcctcgcaaggacagcaccggtctgctccgctattgcgtccag
aagcacgacgccagccgcctgcactacgacttccgcctggagctggatggcaccttgaag
agctgggcggtgcccaaggggccgtgcctcgacccggcggtgaagcggctcgcggtgcag
gttgaggaccatccgctggactatgccgatttcgaaggcagcatcccccaggggcactac
ggcgccggcgatgtcatcgtctgggaccgaggcgcctggacgcctctggacgatccgcgc
gagggcctggaaaagggccatctcagcttcgccctggatggcgagaaactctccgggcgt
tggcacctgatccgcaccaacctgcgcggcaagcagccccagtggttcctggtcaaggcc
aaggacggcgaggcgcgcagcctggattgcttcgacgtgctgaaggagcgtcccgacagc
gtgctcagcgagcgtacgctgctgccccgccatggcgaagccgccacgcccgcggccagg
ccggcgcgacgcggcaagagcggggggaagacgccgatgcccgaatggatcgcccccgag
ctggccagcctggtcgagcagcctccgcgaggggagtgggcctacgaactcaagctggac
ggctatcggctgatgagccgcatcgaagacggccacgtgcgcctgctgacccgcaacggc
catgactggaccgaacgcctgccgcacctggagaaggcattggccgggctcggtctgcag
cgcagttggctggacggcgaactggtggtcctcgacgaggagggtcgaccggacttccag
gccctgcagaacgccttcgaggaaggtcgcggcgagaacatcctgtacgtcctcttcgac
ctgccgtaccacgaaggcgaggatctgcgcgatgtcgccctggaggagcgccgcgcgcgc
ctggaggcgctgctggaagggcgcgacgaagacccgctgcggttctccgcgacgctcgcg
gaagacccccgcgacctgctggccagcgcctgcaagctcggtctcgaaggcgtgatcggc
aagcgtctgggcagcgcctaccgttcgcgccgcagcaacgactggatcaagctgaagtgc
cagttgcgccaggagttcgtgatcgtcggctataccgagccgaagggctctcgccggcat
atcggcgccttgctgctcggcctctacagccctgacgaggagcgccggctgcgctatgcc
ggcaaggtcggcagcggcttcaccgcggccagcctgaagaaggtccgtgagcgcctggaa
cccctcgcggtccgctccagcccattggcgaaggtgccgccggcgcgcgagaccgggtcg
gtgcagtgggtgcgcccgcaacagctgtgcgaggtttcctatgcgcagatgacccgtggc
gggatcatccgccaggcagtgttccacggcttgcgcgaagacaagccggcgcgcgaggtg
accggcgagcgtcccgccggcccgccgccgctgcgcggcgcgcgcaaggccggcgccggt
gcgtcgcgggcggccaccgccggcgtgcgcatcagccatccgcagcggctgatcgacccg
tcgatccaggccagcaagctggaactcgccgagttccatgcgcgctacgccgacctgctc
ctgcgcgacctgcgcgagcgcccggtgtcgctggtgcgcggccccgacggaatcggcggc
gaactgttcttccagaagcacgcggcgcgcctgaagatccccggcatcgtccagctcgac
ccggcgctcgatcccggtcatccgccgctgttgcagatccgcagcgccgaggcgctggtc
ggcgcggtgcagatgggcagcatcgaattccatacctggaacgccagcctggccaacctg
gagcggcccgaccgtttcgtcctcgacctcgacccggacccggcgctgccgtggaagcgc
atgctcgaagcgacccagctgagcctgacgttgctcgacgagctgggcctgcgcgccttc
ctcaagaccagcggcggcaagggcatgcacctgctggtgccgctggagcgccggcatggc
tgggacgaggtcaaggatttcgcccaggccatctcccagcacttggcgcgcctgatgccg
gagcgtttctcggcggtttccgggccgcgcaaccgggtcggcaagatcttcgtcgactac
ctgcgcaacagccgcggcgccagcaccgtggccgcctactcggtgcgcgcccgcgaaggg
ttgccggtgtcggtaccggtgttccgcgaggaactcgactcgctgcagggcgccaaccaa
tggaacctgcgcagtctgccgcagcgcctcgacgaactcgccggcgacgatccctgggcc
gactacgccggcacccgccagcgcatcagcgcggccatgcggcgccagctcgggcgcggc
tga

DBGET integrated database retrieval system