KEGG   Propionibacterium acnes TypeIA2 P.acn17: TIA2EST22_08915Help
Entry
TIA2EST22_08915   CDS       T01654                                 

Definition
(GenBank) superoxide dismutase (Mn/Fe)
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pav  Propionibacterium acnes TypeIA2 P.acn17
Brite
Enzymes [BR:pav01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TIA2EST22_08915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1934596..1935213
Genome map
AA seq 205 aa AA seqDB search
MAVYTLPDLDYDYGALEPHISGKIMELHHDKHHNTYVQGANTALEKLAEAREKGDFGTIN
KLEKDLAFNLGGHINHSVFWKNMSPHGGGRPEGNELAAAIDEFFGSFDSFKKQFEETAKG
VQGSGWGMLVWDVMGQRLNTMQLFDHQGNLPSTQIPVVQLDMWEHAYYLQYQNVKADYVT
AWWNVVSWTDAEQRFVKARSITGLF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttacacccttcccgatctcgactacgactacggagcactggagccccacatc
tcgggcaagatcatggaactgcaccatgacaagcaccacaacacctacgttcagggtgcc
aacaccgccctggagaagctggccgaggcccgcgagaagggcgacttcggaaccatcaac
aaactcgaaaaggacctggcctttaacctcggcggccacatcaaccactccgtgttctgg
aagaacatgtcccctcatgggggcggtcgtccggagggcaacgaactcgctgctgcgatt
gacgagttcttcggttcctttgacagcttcaaaaagcagttcgaggaaaccgctaagggc
gttcagggctccggctggggcatgctcgtgtgggacgtgatgggtcagcgcctcaacacc
atgcagctgtttgaccaccagggcaatctgccgtcaacccagatcccggtcgtccagctc
gacatgtgggaacacgcttattacctgcagtaccagaacgtcaaggccgactacgttacc
gcctggtggaacgtcgttagctggaccgacgccgagcagcggttcgtcaaggcccgttcg
atcaccggtttgttctga

DBGET integrated database retrieval system