KEGG   Prunus avium (sweet cherry): 110764337Help
Entry
110764337         CDS       T05161                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pavi  Prunus avium (sweet cherry)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:pavi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    110764337
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110764337
Enzymes [BR:pavi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     110764337
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 966 aa AA seqDB search
MASRNLEKMASIDAQLRLLAPGKVSEDDKLIEYDALLLDRFLDILQDLHGESLRETVQEC
YELSAEYERKQDPKKLEELGKVLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK
LKKGDFADEASATTESDIEETLKRLVGDLKKSPEEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHARVRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRCNDELLSRAHELHRSSKKDAKHYIEFWKQIP
PNEPYRVILGDVRDKLYSTRERARQLLANGISEIPEETTFTNVEQFLEPLEMCYRSLCSC
GDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITRHLEIGSYREWSEERR
QEWLLSELSGKRPLFGSDVPKTEEIADVLDTFHVISELPSDNFGAYIISMATAPSDVLAV
ELLQRECGVKKPLRVVPLFEKLADLEAAPAAVGRLFSIDWYKNRINGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQEELIKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMAVLATK
EYRSIVFQEPRFVEYFRRATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKQAIDKDAKHLHMLREMYNQWPFFRVTIDLIEMVFAKGDPGIASLYDK
LLVSEDLWSFGERLRANYEETKSLVLQVAGHRALLEGDPYLRQRLLLRDSYITTLNVCQA
YTLKQIRDPNYHVKVRPHLSKEYMEKTSKPAAELVNLNPTSEYAPGLEDTLILTMKGIAA
GMQNTG
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaggaacttagagaagatggcttcaattgacgcacagctgaggctgctggca
ccagggaaggtgtctgaggatgacaaactgattgagtatgatgctttgttattggatcgc
ttccttgacattcttcaggatttacatggagagagtctcagagaaacggtgcaagagtgt
tatgaactttccgcagaatatgaaagaaagcaggaccctaaaaagttggaggaacttggg
aaggttctaacgagtttggatcctggggactcgattgtcattgctaagtccttttctcac
atgcttaacttggccaatttggccgaggaagttcagattgcttatcgaaggaggatcaag
ttgaagaagggagacttcgctgatgaggcttcagctactacagagtcagacattgaagag
actctcaagaggcttgtgggagacctgaagaagtccccggaagaagtttttgatgccttg
aagaaccagactgtagatttggtcctaacggcacatcctactcagtctgttcgaagatcc
ttgcttcaaaagcatgcaagggtaagaaattgtttgacacagttgtatgctaaggacatt
acacctgatgataaacaggaactcgatgaggctctacaaagggagattcaagctgcattt
cgtacagatgaaatccgaaggactcctccaacccctcaagatgagatgagggcgggaatg
agctactttcatgagacaatttggaaaggtgtaccaaaattcttacgtcgtgttgacact
gctttgaagaacatagggataaatgaacgtgttccttacaatgcccctctcattcagttt
tcttcttggatgggtggggaccgtgatggaaaccccagggtcactcctgaagttacacgg
gatgtatgtttgttggctagaatgatggctgctaacttgtacttctcccagatagaggat
cttatgtttgagttatctatgtggcgctgcaatgatgagcttctttctcgtgctcatgaa
ctacataggtcttcaaagaaggatgcaaaacactatatagagttttggaagcaaattcct
ccaaatgagccttatcgcgttattcttggtgatgtaagagacaagctgtacagtacacgt
gaacgtgctcgccaattgttagccaatggaatctctgaaattcctgaggaaacaaccttt
acaaatgttgaacagttcctggagccgctcgaaatgtgttaccggtcactctgctcctgt
ggcgatcgggcaattgctgatggaagccttcttgatttcttacggcaagtttccactttt
gggctctctcttgtgagactagacatacggcaagaatcagacaggcacactgatgtcctc
gatgctataacaaggcacctggagattgggtcttatcgagaatggtccgaggaacgtaga
caagaatggctcttgtctgagcttagtggcaagcgccccctttttggctctgatgttccc
aagactgaagaaattgctgatgtgctggacacattccatgtcatttcagaacttccctca
gacaattttggtgcttatattatctcaatggcgacagcgccatctgatgtgcttgctgtg
gagcttttgcaacgtgaatgtggtgtgaagaaaccactaagggttgtcccattgtttgag
aagcttgctgatcttgaggctgctcctgctgccgtgggccgtctcttttcaatagattgg
tacaaaaacaggatcaatgggaagcaagaagtcatgataggatactcagattcaggaaag
gatgctggccggctctctgcagcatggcagttatacaaggctcaagaagagctcataaag
gttgcgaaacaatatggggttaagcttacaatgtttcacggtcgaggtggaacagttgga
agaggaggggggcccacccatcttgctatattgtctcagccacctgacacaattcatggt
tcacttcgtgttacagttcaaggtgaagttattgaacaatcatttggggaggagcacttg
tgctttagaacactccagcgtttcacagcagctacacttgagcatggaatgcatcctcct
gtctcaccaaagcccgaatggcgtgcactaatggatgagatggctgtccttgcaacaaag
gaataccgttcaatagttttccaggaacctcgttttgttgaatactttcgccgtgcaaca
ccagagttggagtatggccggatgaacattgggagtcgtccttcaaaacgaaagccaagt
ggaggcattgaatcactacgtgcaatcccatggatatttgcttggacccaaacaagattt
catttaccagtgtggcttgggtttggggcagcatttaagcaagctattgataaggatgcg
aaacatctccatatgcttcgagagatgtataatcagtggcctttcttcagagtcacgatt
gatttaattgagatggtgtttgccaagggcgacccgggtattgcctctctgtatgacaag
cttcttgtgtcagaagacctatggtcatttggagagagattgagggccaactatgaagaa
actaagagcctcgtcctccaggttgctggacatagagctcttctggaaggagatccttat
ttgaggcagagactcctcctccgtgactcttacatcaccacacttaatgtgtgccaagcc
tatacactgaagcagattcgtgatccgaactaccatgttaaagtaaggccacacttgtca
aaggagtacatggaaaaaacaagcaagccagcggcagagcttgtaaatcttaatccaacg
agcgagtatgctcctggactagaagacacacttattttgaccatgaagggtattgctgct
ggcatgcagaataccggctga

DBGET integrated database retrieval system