KEGG   Propionibacterium acnes TypeIA2 P.acn31: TIA2EST36_03430Help
Entry
TIA2EST36_03430   CDS       T01655                                 

Definition
(GenBank) BNR/Asp-box repeat protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
pax  Propionibacterium acnes TypeIA2 P.acn31
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:pax00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TIA2EST36_03430
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TIA2EST36_03430
Enzymes [BR:pax01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     TIA2EST36_03430
Bacterial toxins [BR:pax02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   TIA2EST36_03430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(743351..745666)
Genome map
AA seq 771 aa AA seqDB search
MTITDTYTEELAIDLTGSALMPARKGMDVQRIDGEDGSLLVEFSATSSGCLFELVGKNGR
LSVDVDEDRLLGRIDLNGESRSLDAEDALGMADGTIHSVGLTADETGTHLFADGYETFSA
TLRVWCQDLGATNIVINPSGVLDVRRFKMWNSALSLQAMAAKAPTATPFVEFAGSELSAR
DARRIGELAHGALRARTRLRGKGQGGTVLAAQGSAGELSFEIVNGDLLLHVEVDDEPIAH
VRAPGKWDDGNWHDLVAISGRGAIDLYVDGFLVAHEPGEAFFADLGKVERVTAGKDLEGA
RLFGEAQTASIFSSALTDAQVKRLANVAPLRTQALFDTGYLGSKSYRIPSLIRLDSGSFI
AGADQRVSIANDSPNDINFVIRRSEDGRRWDEAQIVLEYPGEGALGASVIDSVLFQDHNS
GRVFCLIDQFPGGVGQPNAEPGSGFDEQGRQLLFDRDATAYVIDAEGIVTTESGEPTDYT
VDETGNVFAAGAPAGNIHLATGVDPHESLLTLRTCNLILIHSDDDGRTWSRPINLNPALK
QPWMRFLGTSPGNGIQLEHGTHRGRLLAPVYYNHEEGKTFSCAAVYSDDGGQTWNLGKSP
NDERELFGKIVSSRNLNDDRGSTHESALVETPDGVVHSFMRNQHPSGRVAHAASVDGGET
WGEVTFVEQLTEIFSQPNAISVRDELGTESVVFANASMMLPFRGCGVLRQSFDGGKTWPH
NRVLNPRHHVYQCMTQQDEQTLIVLWEREWLGLFLTEVPLSWLTTSRSTLE
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgactattactgatacttataccgaggaattggcgattgacctcactgggagcgccttg
atgccggcccgaaagggcatggacgtgcaacgaatcgacggcgaggacggctcacttctc
gtggaattcagcgcgacgtcctccggatgcctgttcgagcttgtcggaaagaacggacgg
ttatcagtcgatgtggatgaagaccgcttgcttggccgtatagatctgaacggagaatct
cgcagtctcgacgccgaggatgcgctgggcatggcagatggcacgattcactccgtcgga
ctcaccgccgatgaaactgggacgcatttgtttgcagacggttacgaaacattctccgcc
acattgcgggtatggtgccaggatctgggagcaaccaatattgtcatcaatccgtcgggc
gtcctcgacgtacggcgattcaagatgtggaactcagccctgtccttgcaagctatggca
gccaaggcgccgacggcaacaccgttcgtcgagttcgctggttctgaactgtcggcccgc
gacgcacgccgtatcggagaactcgctcatggcgcgctccgagcaaggacccgtcttcgt
ggcaaaggccagggtggaaccgtcctcgcagcccaagggagcgccggtgaactgtccttc
gagatcgtcaacggcgacctgctcctgcacgtggaagtggacgatgaacccatcgcccac
gtgcgcgctccaggcaagtgggacgacggaaactggcatgacctggtagcaatcagtggc
cggggtgccattgatctctatgttgacggtttcctcgtggctcacgagcctggtgaggca
ttctttgccgatcttggcaaggtggaaagggtgaccgccgggaaggacctcgaaggagca
cggctattcggggaagcacagacggcgtccatcttcagcagtgcgctaaccgacgcccaa
gtcaaacgcctagccaacgtggctcctctacgtacccaagctctcttcgacacgggatat
ctgggctcgaaaagttaccggatcccatcgctcatcagacttgattccggaagcttcatc
gccggggcagaccaacgtgtcagcattgccaacgacagccccaacgacatcaatttcgtc
atccgtcgcagcgaagacggtcgtcggtgggacgaggcccagatagtcctcgagtatccc
ggcgagggcgccctcggagcatcggttatcgactcagttctgttccaagaccacaactca
gggcgcgtgttctgcttgatcgaccagttcccgggtggcgtggggcagcctaacgccgaa
ccagggtcgggcttcgatgagcaaggtcggcagcttctgttcgatcgcgatgcaaccgcc
tacgtcatcgatgcagaaggcatcgtaacaaccgagtcgggggaacccacggattacacc
gttgacgaaaccggaaacgtcttcgcagccggtgcccccgccggcaatatccacttggcc
accggagtggacccccacgagtccctgctgaccctacggacctgcaacctcatcctcatc
cacagtgatgacgacggacggacatggtcacgacctatcaacctgaacccggctctcaag
cagccttggatgcggttcctcggtacgtcaccgggcaacggaattcagttggaacacggg
acgcaccgaggccgactcctggcaccggtctactacaaccacgaggagggaaaaaccttt
tcatgtgccgcggtgtacagcgatgacgggggccagacatggaacctcggtaagtcaccg
aatgacgagcgcgaacttttcggaaagatcgtcagttctcgaaatctcaacgatgatcgc
ggctcgacccatgagtcagcgttagtagaaacccctgacggggtcgtgcactccttcatg
cgcaaccaacatccctccggacgggtggcgcacgcggccagcgtcgacggcggcgaaaca
tggggcgaggtgacgttcgtcgagcaactgaccgaaatcttctcccagcccaatgccatt
tctgtccgggatgagcttggaaccgaatcggtggtctttgccaatgcgtcgatgatgctc
ccgttccggggttgtggtgtgctgcgtcaaagtttcgacggaggcaagacctggccgcac
aaccgcgtgctcaaccctcgccatcatgtgtaccaatgcatgactcagcaagacgaacag
accctgatcgtattgtgggaacgggagtggctaggcttgttcctgacagaggtcccgttg
tcatggcttaccacttcgcgcagcacgctggagtga

DBGET integrated database retrieval system