KEGG   Pogonomyrmex barbatus (red harvester ant): 105428570Help
Entry
105428570         CDS       T04903                                 

Definition
(RefSeq) hexokinase type 2 isoform X1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pbar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105428570
   00051 Fructose and mannose metabolism
    105428570
   00052 Galactose metabolism
    105428570
   00500 Starch and sucrose metabolism
    105428570
   00520 Amino sugar and nucleotide sugar metabolism
    105428570
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    105428570
Enzymes [BR:pbar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     105428570
Membrane trafficking [BR:pbar04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    105428570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 484 aa AA seqDB search
MKTKNRSLFSRLCKCYSKKGTLRRYENADSSFQESEPCLNPTVEIRDACKDLVLSDNQLR
LVMQKLTEEINRGLSKETHDNAIVKCFTTYVQDLPNGTEKGNFLALDLGGTNFRVLLITL
DGQNFDMKSKIYAIPQSLMLGTGIQLFDHIAQCLALFVKELNLQNEILPLGFTFSFPLTQ
YGLTKGHLVRWTKGFNCSGVIGEDVVALLEEAIGRRNDVKIDVCAILNDTTGTLMSCAWK
NRNCRIGLIVGTGSNACYVEKTKNVQCAIPGNYAENKPHMLINTEWGAFGEEGILDFVIT
DFDRAIDENSINPTKQLFEKMISGMYMGELTRLVLEKLVNAGLLFGGKCSNNLRKRGKFF
TKYVSEIENDPKGRYTNCRDVLAELGMPNVSDQDCENVRYVCSVVSRRAAHLVSAGIAAL
LNKMGENNVTVGIDGSVYRFHPHFHDLMTAKISELQKYKFDLMLSEDGSGRGAALVAAVA
SQRR
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgaagaatagatcgttattcagccggctatgcaagtgttacagcaaaaaggga
acattgcggagatatgaaaacgcagattcgtcttttcaggaatcggaaccatgcctaaat
ccaacagttgagatacgagatgcctgtaaggaccttgtcctatccgataaccagctccga
ctggttatgcagaaactcaccgaggagatcaataggggtttgtcgaaggaaacccatgat
aatgcaatcgtcaaatgctttactacctacgtgcaggatctgccaaacggcactgaaaag
ggcaacttcttggcactagatttaggcggtacaaattttagagtgttattaatcacattg
gatggtcaaaattttgatatgaaaagcaagatctatgccatacctcaaagtttgatgcta
ggaactggtatccagctattcgatcacatcgcccaatgtttggcattgtttgtaaaggaa
ttaaatttgcagaatgaaatattaccattaggcttcacctttagctttccccttacccaa
tatggattgacgaagggtcatctagtgagatggaccaagggcttcaattgtagtggtgta
atcggtgaagatgtcgttgctcttcttgaagaagcaattggtagaagaaatgatgttaag
attgatgtatgcgcgatcctaaatgacaccactggcactttaatgtcatgtgcttggaaa
aatcgaaattgtcgaattggtttaatcgttggtaccggaagtaatgcttgctatgtcgaa
aagacaaagaacgtacagtgcgcgattccaggcaattatgctgaaaacaaacctcatatg
ctcatcaatacggaatggggcgcatttggtgaggaaggcatattagattttgtaataacc
gattttgatcgtgccatagatgaaaactctattaatcctacgaaacagctgtttgagaaa
atgatctcaggaatgtatatgggtgaactaacgagactggttctggaaaaattggtcaat
gctggccttctttttggtggcaaatgttccaacaatcttagaaaacgcggcaagttcttc
acgaagtatgtctctgagattgaaaacgatcctaagggaagatacacgaattgccgagac
gtattggctgaactaggaatgccaaatgtgagtgatcaagattgtgaaaatgtgagatat
gtatgctcagtagtgtcgaggagagcagcgcacttggtgagcgcaggaatagcggcattg
ctgaacaaaatgggagagaataatgtcacagtaggcatcgatggttcggtatatcgattt
catccgcactttcacgatctcatgacagcgaagattagtgaacttcaaaaatataagttt
gacttgatgctctcggaggatggtagcggtcgaggtgccgctctggttgctgcagtggcg
tcgcagaggcggtga

DBGET integrated database retrieval system