KEGG   Phycisphaerae bacterium SM-Chi-D1: SMSP2_00831Help
Entry
SMSP2_00831       CDS       T04749                                 

Gene name
nedA_2
Definition
(GenBank) Sialidase precursor
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
pbas  Phycisphaerae bacterium SM-Chi-D1
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pbas00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SMSP2_00831 (nedA_2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SMSP2_00831 (nedA_2)
Enzymes [BR:pbas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SMSP2_00831 (nedA_2)
Bacterial toxins [BR:pbas02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SMSP2_00831 (nedA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1073529..1074662)
Genome map
AA seq 377 aa AA seqDB search
MNRIIIYVMFLVGLTGCFASENKEDIKQTVLFVSGKKGYSTYRIPAIAVSTKGTVIAVCE
GRKNSRSDTGDIDLLVRRSVDAGDTWSEQQVIWDDGPNTCGNPCLVVDKITGTIWLLSTH
NPGEDNEKEIIDDTGIGTRTVWIMHSDDDGRNWSEPVEITSSVKKPDWTWYATGPGAGIQ
LKKGEHKGRLVIPCDHIEADTKKYYSHIIYSDDHGKTWKLGGSTPQDMYNECEVVELDDG
RLMLNMRNYDRAKKDRAYSYSGDGGLSWSDVRHDQSLIDPICQASIRRYDKSAKSYLLFS
NAASTDKRLNMTVRLSCDQGKTWPDSKRLYSGPSAYSCLAVLADGRVACFYENGYYERIT
LAVFTLDWLLDKYESLE
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaattataatatatgtcatgtttcttgttggtttaactggctgttttgcaagt
gagaataaagaagatattaagcagacagtccttttcgttagcggcaagaaaggctattcc
acataccggatccccgccattgcagtttcgacaaagggtactgttattgcggtttgtgaa
ggcaggaagaatagccgttcggatacgggcgatattgacctgctggttcgaaggtccgtt
gatgctggcgatacatggtctgagcagcaggttatctgggatgatggcccgaatacctgc
ggtaatccgtgtcttgtggttgacaagataacgggtaccatctggctgttgtcaactcat
aaccctggagaagacaatgagaaagagattatagacgacacaggcattggcaccagaact
gtctggattatgcatagtgacgacgacggccggaactggtcagagccggttgagatcact
tcatcagtcaaaaagcctgactggacatggtatgctaccggcccgggagcgggaatccag
ttgaaaaagggtgaacataaaggcaggcttgtgattccatgtgaccacattgaagccgat
accaaaaaatattattcacatataatttattcggacgatcacggcaagacctggaagctg
ggtggttctactcctcaggatatgtacaacgaatgcgaagtcgtggagcttgatgatgga
cggttgatgctgaatatgcgaaactatgaccgtgcaaagaaagaccgcgcatacagttat
agtggtgatggcggtttgagctggtcagatgtcaggcatgaccaaagtctgattgatccg
atctgccaggcaagtatccgccgttacgataaatctgccaaaagttatttgttattttca
aatgctgccagtacagataaacgtctcaatatgactgttcgcctgagttgtgaccaaggt
aagacctggccggattcaaaaagactgtattccggaccttctgcatattcctgtctcgca
gtactggcagacggaagggttgcgtgtttttatgaaaatggatactatgagaggatcacg
cttgctgtattcacactcgattggcttttagataaatacgaatcactggaataa

DBGET integrated database retrieval system