Prionailurus bengalensis (leopard cat): 122484468 Help Entry 122484468         CDS       T07574                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism pbg  Prionailurus bengalensis (leopard cat) Pathway pbg01523   Antifolate resistance pbg04010   MAPK signaling pathway pbg04014   Ras signaling pathway pbg04024   cAMP signaling pathway pbg04062   Chemokine signaling pathway pbg04064   NF-kappa B signaling pathway pbg04066   HIF-1 signaling pathway pbg04071   Sphingolipid signaling pathway pbg04137   Mitophagy - animal pbg04151   PI3K-Akt signaling pathway pbg04210   Apoptosis pbg04211   Longevity regulating pathway pbg04218   Cellular senescence pbg04380   Osteoclast differentiation pbg04613   Neutrophil extracellular trap formation pbg04620   Toll-like receptor signaling pathway pbg04621   NOD-like receptor signaling pathway pbg04622   RIG-I-like receptor signaling pathway pbg04623   Cytosolic DNA-sensing pathway pbg04625   C-type lectin receptor signaling pathway pbg04657   IL-17 signaling pathway pbg04658   Th1 and Th2 cell differentiation pbg04659   Th17 cell differentiation pbg04660   T cell receptor signaling pathway pbg04662   B cell receptor signaling pathway pbg04668   TNF signaling pathway pbg04722   Neurotrophin signaling pathway pbg04917   Prolactin signaling pathway pbg04920   Adipocytokine signaling pathway pbg04926   Relaxin signaling pathway pbg04931   Insulin resistance pbg04932   Non-alcoholic fatty liver disease pbg04933   AGE-RAGE signaling pathway in diabetic complications pbg04936   Alcoholic liver disease pbg05010   Alzheimer disease pbg05022   Pathways of neurodegeneration - multiple diseases pbg05030   Cocaine addiction pbg05132   Salmonella infection pbg05133   Pertussis pbg05134   Legionellosis pbg05135   Yersinia infection pbg05140   Leishmaniasis pbg05142   Chagas disease pbg05145   Toxoplasmosis pbg05146   Amoebiasis pbg05152   Tuberculosis pbg05160   Hepatitis C pbg05161   Hepatitis B pbg05162   Measles pbg05163   Human cytomegalovirus infection pbg05164   Influenza A pbg05165   Human papillomavirus infection pbg05166   Human T-cell leukemia virus 1 infection pbg05167   Kaposi sarcoma-associated herpesvirus infection pbg05168   Herpes simplex virus 1 infection pbg05169   Epstein-Barr virus infection pbg05170   Human immunodeficiency virus 1 infection pbg05171   Coronavirus disease - COVID-19 pbg05200   Pathways in cancer pbg05202   Transcriptional misregulation in cancer pbg05203   Viral carcinogenesis pbg05207   Chemical carcinogenesis - receptor activation pbg05208   Chemical carcinogenesis - reactive oxygen species pbg05212   Pancreatic cancer pbg05215   Prostate cancer pbg05220   Chronic myeloid leukemia pbg05221   Acute myeloid leukemia pbg05222   Small cell lung cancer pbg05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pbg05321   Inflammatory bowel disease pbg05415   Diabetic cardiomyopathy pbg05417   Lipid and atherosclerosis pbg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pbg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122484468 (RELA)    04014 Ras signaling pathway     122484468 (RELA)    04064 NF-kappa B signaling pathway     122484468 (RELA)    04668 TNF signaling pathway     122484468 (RELA)    04066 HIF-1 signaling pathway     122484468 (RELA)    04071 Sphingolipid signaling pathway     122484468 (RELA)    04024 cAMP signaling pathway     122484468 (RELA)    04151 PI3K-Akt signaling pathway     122484468 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     122484468 (RELA)   09143 Cell growth and death    04210 Apoptosis     122484468 (RELA)    04218 Cellular senescence     122484468 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     122484468 (RELA)    04620 Toll-like receptor signaling pathway     122484468 (RELA)    04621 NOD-like receptor signaling pathway     122484468 (RELA)    04622 RIG-I-like receptor signaling pathway     122484468 (RELA)    04623 Cytosolic DNA-sensing pathway     122484468 (RELA)    04625 C-type lectin receptor signaling pathway     122484468 (RELA)    04660 T cell receptor signaling pathway     122484468 (RELA)    04658 Th1 and Th2 cell differentiation     122484468 (RELA)    04659 Th17 cell differentiation     122484468 (RELA)    04657 IL-17 signaling pathway     122484468 (RELA)    04662 B cell receptor signaling pathway     122484468 (RELA)    04062 Chemokine signaling pathway     122484468 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     122484468 (RELA)    04917 Prolactin signaling pathway     122484468 (RELA)    04926 Relaxin signaling pathway     122484468 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     122484468 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     122484468 (RELA)   09149 Aging    04211 Longevity regulating pathway     122484468 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     122484468 (RELA)    05202 Transcriptional misregulation in cancer     122484468 (RELA)    05207 Chemical carcinogenesis - receptor activation     122484468 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     122484468 (RELA)    05203 Viral carcinogenesis     122484468 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     122484468 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     122484468 (RELA)    05221 Acute myeloid leukemia     122484468 (RELA)    05220 Chronic myeloid leukemia     122484468 (RELA)    05215 Prostate cancer     122484468 (RELA)    05222 Small cell lung cancer     122484468 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     122484468 (RELA)    05170 Human immunodeficiency virus 1 infection     122484468 (RELA)    05161 Hepatitis B     122484468 (RELA)    05160 Hepatitis C     122484468 (RELA)    05171 Coronavirus disease - COVID-19     122484468 (RELA)    05164 Influenza A     122484468 (RELA)    05162 Measles     122484468 (RELA)    05168 Herpes simplex virus 1 infection     122484468 (RELA)    05163 Human cytomegalovirus infection     122484468 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     122484468 (RELA)    05169 Epstein-Barr virus infection     122484468 (RELA)    05165 Human papillomavirus infection     122484468 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     122484468 (RELA)    05135 Yersinia infection     122484468 (RELA)    05133 Pertussis     122484468 (RELA)    05134 Legionellosis     122484468 (RELA)    05152 Tuberculosis     122484468 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     122484468 (RELA)    05145 Toxoplasmosis     122484468 (RELA)    05140 Leishmaniasis     122484468 (RELA)    05142 Chagas disease     122484468 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     122484468 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     122484468 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     122484468 (RELA)   09165 Substance dependence    05030 Cocaine addiction     122484468 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     122484468 (RELA)    05418 Fluid shear stress and atherosclerosis     122484468 (RELA)    05415 Diabetic cardiomyopathy     122484468 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     122484468 (RELA)    04932 Non-alcoholic fatty liver disease     122484468 (RELA)    04931 Insulin resistance     122484468 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     122484468 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     122484468 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:pbg03000]     122484468 (RELA) Transcription factors [BR:pbg03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     122484468 (RELA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  122484468 NCBI-ProteinID:  XP_043438473 LinkDB All DBs Position D1:complement(109269200..109278022) Genome browser AA seq 555 aa AA seqDB search MDDLFPLIFPTEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLPPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPPPRRIAVPSRSSAAVPKPAPQPYPFTPSLSTINF EEFSPMVFPSGQIPSQTPALAPAPAPILAPAPASVPAPAPVPAPAPAPAPAPAPILAPGL AQAVVPPAPKTTQAGEGTLTEALLHLQFDADEDLGALLGNSADPAVFTDLASVDNSEFQQ LLNQGVSVAPHPAEPMLMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSS IADMDFSALLSQISS NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt atggatgacctgtttcccctcatcttcccgactgagccggcccaggcctctggcccttat gtggagatcatcgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggt cgctccgcgggcagtatccccggcgagaggagcacggataccaccaagacccaccccacc atcaagatcaatggctacaccgggccagggacagttcgcatctcattggtcaccaaggac cctcctcatcggcctcacccccatgagctggtgggaaaagactgccgggatggcttctat gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgggacctggagcaggccatcagtcaacgtatccagaccaacaacaatccc ttccaagttcccatagaagagcagcgtggggactacgacctgaatgcggtgcggctctgc ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgccacctgtcctctcg catcccatctttgacaaccgtgcccccaacaccgcggagctcaagatctgccgagtgaac cgaaactctgggagctgcctcgggggggatgagatcttcctgctgtgtgacaaggtgcag aaagaggacattgaagtgtatttcacgggaccaggctgggaggcccgaggctccttttct caagctgacgtacaccgacaagtggccattgtgttccggacacctccctatgccgacccc agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc agcgagcccatggaatttcagtacttgccagacacagatgatcgtcaccggattgaggag aaacgcaaaaggacatacgagaccttcaagagcatcatgaaaaagagtcctttcaatgga cccaccgacccccggcctccaccccggcgcattgctgtgccttcccgaagctcagctgcc gtccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttc gaggagttctcccccatggtcttcccttccgggcagatcccaagccagacccctgccttg gcaccagcccctgccccaatcctggccccggcccctgcctctgtcccggcccctgcccct gtccccgcccctgccccggccccagccccggcccctgccccaatcttagccccaggcctt gctcaggctgtggtcccgcctgctcccaagaccacccaggctggggaagggacgctgacg gaggccctgctgcacctgcagtttgacgccgatgaagacctgggggccctgctcggcaac agcgccgacccagcagtgttcacagacctggcatccgtcgacaactctgagtttcagcag ctgctgaaccagggtgtatctgtggccccccacccagctgagcccatgctgatggaatac cctgaggcaataactcgcctggtgacgggatcccagaggccccctgacccagctcccgct cccctgggggcctctgggcttcccaacggcctcctctcaggggatgaagacttctcttcc attgccgacatggacttttcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system