Caldimonas brevitalea: AAW51_1420 Help Entry AAW51_1420        CDS       T04216                                  Symbol xseB Name (GenBank) exodeoxyribonuclease VII   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism pbh  Caldimonas brevitalea Pathway pbh03430   Mismatch repair Brite KEGG Orthology (KO) [BR:pbh00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     AAW51_1420 (xseB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pbh03400]     AAW51_1420 (xseB) Enzymes [BR:pbh01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      AAW51_1420 (xseB) DNA repair and recombination proteins [BR:pbh03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      AAW51_1420 (xseB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S Motif Other DBs NCBI-ProteinID:  AKJ28111 UniProt:  A0A0G3BL63 LinkDB All DBs Position 1628844..1629083 Genome browser AA seq 79 aa AA seqDB search MPNTATSSHTAEPASYEEALAELERLVSELESGQLPLERLLQSYQRGAHLLAYCRGRLET VEQQVKVLEEGQLKPWNQA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgcccaacaccgcaacctcttcccacactgcagagccggccagctatgaagaagcgctg gccgagctcgagcggctggtgtccgagctcgaatcgggccagctgccgctcgagcgcctg ctgcagagctaccagcgcggcgcgcatttgctggcctactgccgtggcaggctcgagacg gtggagcagcaggtgaaggtgttggaagaggggcaattgaaaccttggaatcaagcatga

DBGET integrated database retrieval system