KEGG   Polyangium brachysporum: AAW51_5505Help
Entry
AAW51_5505        CDS       T04216                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pbh  Polyangium brachysporum
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pbh00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AAW51_5505
Enzymes [BR:pbh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AAW51_5505
Transporters [BR:pbh02000]
 Other Transporters
  Pores ion channels [TC:1]
   AAW51_5505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6419747..6420415)
Genome map
AA seq 222 aa AA seqDB search
MIVVHHLNNSRSQRVLWLLEELELPYEVKRYERDPKTMLAPASLVAVHPLGKSPVISDGD
LTLAESGAILEYLAGRYGAGRLVPPEGSPERLRYTYWMHYAEGSAMPPLLLKLIFDRIET
APMPFFAKPVARSIAGRAKAMMVTPQLARHLDFLEGELAGRDWFAGDTFSAADIQMSFPL
EAAAARAGLDQSRPRLMNFLERLHARPAYRRALEKGGPFRLK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgtccaccacctcaacaactcccgctctcagcgtgtgctctggttgctcgaa
gaactcgaacttccttatgaagtgaagcgttacgagcgcgacccgaagaccatgctcgcg
ccggcctcgctggtcgccgtgcacccgctgggcaagtcgcccgtgatcagcgacggcgac
ctgacgctggcggagtccggggccattctggagtacctggccgggcgttatggcgccggc
cgactggtgccgccggaaggcagccccgagcggctgcgctacacctactggatgcactat
gccgagggctcggcgatgccacccttgctgctgaagctgatcttcgatcgcatcgagacc
gcgccgatgccgttcttcgccaagcccgtggcccgctcgatcgccggccgcgcaaaggcg
atgatggtcacgccccagttggctcgtcacctcgatttcctcgagggtgaactggccggg
cgtgattggtttgccggcgacaccttcagtgcggccgacatccagatgagcttcccgctc
gaggcggccgccgcgcgagcagggctcgaccagagccggccccggctgatgaactttctc
gagcgtctccacgcccgccctgcctatcgccgtgcgctggaaaaaggcgggccgttccgg
ctgaagtaa

DBGET integrated database retrieval system