KEGG   Python bivittatus (Burmese python): 103059250Help
Entry
103059250         CDS       T03091                                 

Definition
(RefSeq) pancreatic alpha-amylase-like
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00500  Starch and sucrose metabolism
pbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    103059250
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     103059250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-GeneID: 103059250
NCBI-ProteinID: XP_007424834
LinkDB All DBs
Position
Un
AA seq 512 aa AA seqDB search
MWILILLAALELCWAQYSPNTLPGRTSIVHLFEWRWNDIALECERYLAPNGFGGVQISPP
NENLVVTTPWRPWWERYQPISYQLCSRSGNESEFKDMVIRCNNVGVYIYVDAVVNHMCGA
AAGSGHYSTCGSYFDSGKRDFPAVPYSGWDFNDGKCKTTSGEIENYNDLYQVRDCRLVSL
LDLALEKDYVRSKVAEYMNHLIDIGVAGFRIDAAKHMWPGDMKAFLDKLKNLSTEWFAEG
TRPFIFQEVIDLGGESIKSNEYFGNGRVTEFKYGAKLGTVIRKWNGEKMAYLKNWGEGWS
FMPSDKAVVFVDNHDNQRGHGAGGASILTFWDARLYKMGVGFMLAHPYGFTRVMSSFHWP
RYFENGKDINDWVGPPSYEDGSTKPVSINPDTTCGNGWICEHRWRQIRNMVIFRNVVNGQ
PFTNWWDNNSNQVAFGRGNQGFIVFNNDDWNLTATLQTGLPEGIYCDIISGQKEGNICTG
IKIHVHGDGTAYFNISNDAEDPFVAIHVSAKL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtggattttaattctccttgctgctctggagctttgttgggctcaatatagcccaaat
acattgcctggaaggacgtctattgttcacctctttgaatggcgttggaacgacattgct
cttgaatgtgaacgttacttagcgcctaatggatttggtggagttcagatctctcctcca
aatgaaaaccttgttgttacaacaccatggagaccatggtgggaaagataccaacccatc
agctaccagctatgttcacgatctggaaatgagagtgaatttaaagacatggtgatcaga
tgtaacaatgttggagtatacatttatgtggatgctgttgtcaaccatatgtgtggggct
gctgctggatctggccactattctacatgtggaagttactttgattcagggaagcgagat
tttcctgctgtaccctattccgggtgggacttcaatgatgggaaatgcaaaactacaagt
ggagagatagaaaattataatgacctttaccaggttcgggactgtcgccttgttagtctt
cttgatcttgcactagagaaggactacgtgcgttccaaagttgcagagtatatgaaccat
ctaattgacattggtgtggcaggatttcgaatagatgctgccaagcacatgtggcctgga
gatatgaaagcatttctagacaaactaaaaaatctcagcacagagtggtttgctgaaggg
acaaggccattcatcttccaagaggtgattgatctaggtggggagagcattaaatccaat
gagtacttcggaaatggccgagtaactgaattcaaatacggtgcaaaactagggacagtc
attcgcaagtggaatggagaaaagatggcttatttgaagaactggggtgaaggctggagt
tttatgccttctgataaagctgtggtctttgtagacaatcatgataatcagagaggtcac
ggggctggtggagcttccattttgaccttctgggatgccaggctctataaaatgggagtt
ggcttcatgcttgcacatccgtatggctttacaagagtcatgtcaagtttccactggcct
agatattttgaaaatggaaaggatattaatgactgggttggacctcccagttatgaagat
ggatcaactaaacctgtatcaattaatccagacacaacctgtggcaatggctggatctgt
gaacatcggtggcgtcaaataagaaatatggttattttccgcaatgttgtgaatgggcag
ccatttaccaattggtgggacaataacagcaatcaagtggcatttggtcgtggcaaccaa
ggatttattgtcttcaataatgatgactggaatctgactgcgactttgcagactggcctt
cctgaaggaatttactgtgatattatatctgggcagaaggagggtaatatctgtactgga
attaaaatccatgtccatggagatggcactgcttattttaacattagcaatgatgctgag
gatccatttgttgccattcatgtcagtgctaaattataa

DBGET integrated database retrieval system