KEGG   Python bivittatus (Burmese python): 103063043Help
Entry
103063043         CDS       T03091                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
pbi00590  Arachidonic acid metabolism
pbi01100  Metabolic pathways
pbi04370  VEGF signaling pathway
pbi04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pbi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    103063043 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    103063043 (PTGS2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    103063043 (PTGS2)
Enzymes [BR:pbi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103063043 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 103063043
NCBI-ProteinID: XP_007435833
LinkDB All DBs
Position
Un
AA seq 570 aa AA seqDB search
MTKGFDQYECDCTRTGFYGENCTTPEFYTWLRLKLKPAPDTVHYILTHFKGIWDIINNIP
FLHNAIMRYILMSRSHLIESPPTYNGRYGYKSWEAYSNLSYYTRTVPPVDHDCPTPMGVK
GKKELPDSKVIVEKFLLRRKFIPDPQGTNVMFTFFAQHFTHQYFKTDTQKGPAFTKGLGH
GVDLSHIYGETLDRQMKLRLLKDGKLKFQMIGGEMYPPTVKETQAEMIYPPHIPDHLKFS
VGQEVFGLVPGLMMYATLWLREHNRVCDILKGEHPEWDDEQLFQTTRLILIGETIKIVIE
DYVQHLSGYHFKLKFDPELLFNQQFQYQNRIAAEFNTLYHWHPLLPDTFQIHNQEYTYPQ
FMYNNSIMLEHGLSHMVQSFSKQRAGRVAGGRNVPAVVQNVAKASIDQTRQMRYRSLNEY
RKYFLLKPFTSFEELTGEKEMAAELEELYGDIEAMELYPALLVEKPRPGAIFGETMIELG
APFSLKGLMGNAICSPEYWKPSTFGGRVGFDIVNTASLQRLICNNVKGCPLTAFHVISSE
TVATNNVSTSSRSIDEINPAVLLKERSAEL
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaggttttgatcaatatgaatgtgactgtacgcggactggcttttatggggaa
aactgcacgacaccggaattttatacttggctcagacttaagctaaagcctgctccagac
acggtacactatatactcacacacttcaaaggcatctgggatataatcaacaacattcca
ttcctccacaatgccataatgagatacattctaatgtccagatcccacttaattgaaagc
ccaccaacatataatggccgctatggttacaaaagctgggaagcctattctaatctttcc
tactatactcgaactgttccaccagtggaccatgactgccccactccaatgggtgtgaaa
ggcaagaaggagcttccagattcaaaagtaattgtagaaaaatttttgctaaggagaaaa
ttcattcctgatcctcaaggcacgaatgtcatgttcaccttctttgcccagcatttcact
caccaatacttcaagacagatactcagaaaggaccagccttcacaaaaggtcttggacat
ggggttgatcttagtcacatctatggagagactttggacaggcagatgaaactaagactt
cttaaggacggaaagctaaaatttcagatgattggtggagaaatgtatccacctactgtg
aaagaaactcaggcagaaatgatctatccaccccacatccctgatcacctgaaattttct
gtaggacaggaagtctttggcttggttccagggctgatgatgtatgccacattgtggctt
cgggaacacaatcgagtctgtgacattcttaagggagaacacccagaatgggatgatgaa
caactatttcagaccaccagactgatcttgataggagaaaccatcaagattgtgattgaa
gactatgtgcaacatttaagcggataccatttcaaactgaagtttgatccagaacttctc
ttcaaccagcaatttcaatatcagaacagaatagcagcagagttcaacaccctttaccat
tggcatcctcttcttcctgatacctttcaaatccataaccaagaatacacttacccacag
ttcatgtataacaattccattatgttagaacatggtctttctcacatggtacagtctttc
tccaagcaaagggctggaagggtagctgggggtaggaatgttcctgctgtagtgcagaat
gtagctaaagcttctattgatcaaacccggcagatgagataccgatccttgaatgaatac
cgaaagtactttctgctgaaaccttttacatcatttgaagaacttactggtgaaaaagaa
atggctgcagaacttgaagagctctatggagatattgaagctatggaactgtaccctgct
cttcttgttgaaaagccacgtcctggagccatctttggtgagaccatgattgaacttggg
gctcccttctccttgaaaggtcttatgggaaatgccatctgctcgcctgaatactggaag
ccaagtacttttgggggtagagtgggctttgacattgtgaatacagcctccctccaaaga
ctcatctgcaataatgtgaagggctgtcccctcacagccttccatgtcatcagctctgaa
acagtggcaacaaataatgtcagcacctccagcaggtcgatagatgaaatcaatcctgcc
gtactactcaaagaacggtcagccgaattgtag

DBGET integrated database retrieval system