KEGG   Python bivittatus (Burmese python): 103064233Help
Entry
103064233         CDS       T03091                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pbi  Python bivittatus (Burmese python)
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:pbi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    103064233 (LIG1)
   03410 Base excision repair
    103064233 (LIG1)
   03420 Nucleotide excision repair
    103064233 (LIG1)
   03430 Mismatch repair
    103064233 (LIG1)
Enzymes [BR:pbi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103064233 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     103064233 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103064233 (LIG1)
DNA replication proteins [BR:pbi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103064233 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103064233 (LIG1)
DNA repair and recombination proteins [BR:pbi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103064233 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     103064233 (LIG1)
   MMR (mismatch exicision repair)
    Other MMR factors
     103064233 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 912 aa AA seqDB search
MQSNIRSFFQPLARIKPEKEKAEDNHLEDVLTSQKKLVNGSEVYEDFPVNSASKKAAKVL
NSDDEEDSVELDGKDTQADDSKLEPDCVPEQKISEESISPSTSPTTSSSPTSSGIPRRKT
ARKQLPKRKPEEDVNSHNNSHESRSTKRWKEDHSRDDSKDENGEKSMEVEEVKSENAKLV
EHKTDRNVKEEETSDSPKSSSKPISSFFAPKKSSVKTEKKQAPIVSENMPVPKDLNKVSN
HESNSMADNFLKPSLTPEPPEYNPTKSSYHPVHDACWGPGQKVPYMAVARSFEYIEEESA
RLKIIETLSNLFRSVIVLSPQDLLPCVYLCLNRLGPAYEGLELGIGKTILMKALAQATGR
QLDQIKAEAAEKGDLGLVAENSRTTQGTVFAPPKLGAAAVFGKLQAIGHMAGSSSMNKKI
DIIKSLFVACRHSEARYVARSLEGKLRIGLAEQSVLSALAQAASLTPPGQKFPPDVLDAA
KGKSVETRKAWLDERALIVKQAFCELPNYDIIIPVLLEHGVESLPQHCKITPGIPLKPML
AHPTKGIGEVLKRFEEAAFTCEYKYDGERAQIHILENGEVHIYSRNQENNTTKYPDIVTR
IPKVKNSTVKSCILDAEAVAWDPVSKQILPFQVLTTRKRKDVDAAEIRVQVCVYAFDMLY
LNGMSLVQKPLSQRRTLLHNSFTEVEGQFLFATSMDTSNTDEIAEFLERSIKDSCEGLMV
KTLEVDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIGAYLGKGKRAGTYGGFLLACYD
EESEEFQSICKIGTGFTDEDLEKLHLSLKDCVTPQPRPYYRWGGTAEPDHWLEAQYVWEV
KCADLSISPIHRAASGLVDEEKGISLRFPRFLRIRDDKKPEEATSSAQVAELYRKQQQIQ
NQVSLEKDDDFY
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcaacataagatcattcttccagcctctggcacgaataaagcctgaaaaagaa
aaagcagaagacaaccacttggaagatgtgctcacttcacaaaagaaattagtaaatggt
tcagaagtctatgaagacttcccagtgaattctgcatctaaaaaagctgccaaggtactt
aatagtgatgatgaagaggattctgtggaattagatggaaaggatacacaagcagatgac
agcaagttggaacctgactgtgttcctgagcaaaagatctctgaggagagcatctctcca
agtaccagcccaactacctccagttcacccacatcttctggtattccaaggcgcaaaact
gcccgcaagcagctccctaaacgtaaaccagaggaagatgtcaacagccataataattcc
catgaaagtcgcagtaccaaaagatggaaggaagatcacagtagagatgattctaaagat
gaaaacggtgagaaatccatggaagtggaagaagtgaaaagtgaaaatgcaaaattggtg
gagcataaaacagacagaaatgtaaaggaagaagaaacctcagattcccctaagtcatct
agcaagcccatttctagtttttttgctcccaagaaaagttctgtgaagacagaaaaaaag
caagcacctatagtatcagaaaacatgccagtaccaaaggaccttaataaagttagtaat
catgagtccaacagcatggctgacaattttctcaagccatctcttacacctgaacctcca
gagtacaaccctacgaagagcagctatcatcctgttcatgatgcttgctggggccctggc
caaaaggtaccatacatggctgtggctcgttcttttgagtatattgaggaggaatctgcc
cggttgaaaattatagagaccctgagcaatctctttcgttctgtgattgtcctgtctcca
caagacctgctcccctgtgtctacctctgtctcaatcggttaggcccagcgtatgaaggc
ctagaattaggcattggcaaaaccatcctcatgaaagcgctggcccaagccacaggtcgg
caactggaccaaatcaaggcagaggcagcagagaagggagatctaggattagttgctgaa
aacagtcgcacaacacaaggaaccgtgtttgccccacccaagcttggtgctgctgctgtc
tttggcaaactgcaggcaattgggcacatggcaggaagctcttctatgaacaagaaaatt
gacattatcaagtctctgttcgttgcatgtcgccactcagaggctcgttatgttgctcgg
tcattagaaggaaagttacggattgggctagcagagcagtctgtcctctcagctcttgcc
caggcagcatcgctcactcccccaggacaaaaatttcccccagatgttttggatgctgca
aagggcaaatctgtagaaacacgcaaagcctggctggatgagagagccttgattgttaag
caggccttctgtgaactgccaaattatgacatcatcatacctgtcctcttggagcatggt
gtggagagcttgcctcagcactgcaagatcactccagggattcccctgaagcccatgctg
gctcatccaaccaaaggaattggggaggtattaaagcgctttgaagaggcagccttcact
tgtgaatacaaatatgatggggagcgggcacagatccacattctagagaatggagaagta
catatttatagccgaaaccaagagaacaacacaacaaagtaccctgatattgtcacccgt
attcccaaggtgaaaaacagcactgtgaagtcatgcatcttggatgcagaggcagtggcc
tgggaccctgtttcaaaacagatcctgccattccaagtattgaccacccgcaagcgcaag
gatgtggatgctgcagaaatccgagtgcaggtttgtgtgtatgcattcgacatgctctac
cttaatggaatgtctctagtccagaaacctctgtctcagcgccggaccttactgcataat
tctttcactgaggttgagggccagttcctctttgccacttccatggatactagtaatact
gatgagatagcagaattcctggaacgctctatcaaagactcatgtgaagggttaatggtg
aaaacactggaagtggatgctacatatgaaattgcaaagagatcacacaattggctgaag
cttaaaaaagattatctggaaggtgttggtgacacccttgatctggtggtgattggtgcc
tacctgggcaagggcaagcgggcaggcacgtatggaggtttccttctagcatgttatgat
gaggaaagtgaagagttccagagtatctgcaagattggcactggattcacagatgaggat
ttggagaaacttcatctctcactcaaggactgtgtgactccacagccacgaccatattat
cgttggggtggaacagctgaacctgatcactggttggaagcccagtatgtctgggaagtg
aagtgtgctgatttatccatttctcccatccacagagcagcatcaggtttggtggatgaa
gaaaagggcatctccttacgctttcccagattcctgcgcatccgagatgacaagaaacca
gaggaggccactagcagtgctcaggtggctgaactttatcggaagcagcagcagatccaa
aatcaagtatcactggaaaaagatgacgacttctactaa

DBGET integrated database retrieval system