KEGG   Python bivittatus (Burmese python): 103067603Help
Entry
103067603         CDS       T03091                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pbi  Python bivittatus (Burmese python)
Brite
Enzymes [BR:pbi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     103067603 (ACE)
Peptidases [BR:pbi01002]
 Metallo Peptidases
  Family M2
   103067603 (ACE)
Exosome [BR:pbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103067603 (ACE)
CD molecules [BR:pbi04090]
 Proteins
  103067603 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1278 aa AA seqDB search
MPPVAGFFLSVCFGVAFALDASLMPPNYNNTEEGARLFAKDYNSTGETVFFESVSASWNY
NTNLTDENAQLQVAASLKEQNFTELWGKKAKENYGHNWQNFKDPQLKKIISSIQTLGPSN
LPMNKRHEYNTVLSEMDNIYSTSKVCPPNQSSSCWALEPDITDIMATSRSYRKLLYAWEG
WHNSAGNPLRSKYEKFVSLSNEAYKMDGFQDTGAYWRSWYDSPTFEEDLEQLYQQLEPLY
LNLHAFVRRKLYEQYGSKYINLKGPIPAHLLGNMWAQQWNNIYDMMVPFANKPNLDVTNV
MKQKNWNVTVMFRVAEEFFTSLGMLGMPPEFWEKSMLEKPTDGREVVCHASAWDFFNRKD
FRIKQCTTVTMEQLFTVHHEMGHVEYYLQYKDQPISFRSGANPGFHEAIGDVMALSVSTP
IHLKKIGLLTHASEDKESDINYLLKMALEKIAFLPFGYLIDQWRWNVFSGHTPPSRYNYD
WWYLRTKYQGICPPIARNETNFDPGAKYHIPGNTPYIRYFASFILQFQFHKALCQAANHT
GDLHTCDIYNSKEAGKKLSEALKAGSSRPWQDILQQLTGTNKMDASALLEYFEPVTQWLK
EQNKKTNETLGWPEFDWRPPVPEGYPEGLDKITDEAVAKAFLEEYNSTAEVVWNAYTEAS
WTYNVDINEHNKQIMLEKNLAMSNHTLQNGLKARQFDSTDFKDPSIKRILKKLSDIERAA
LPEAELKEYNQLLSEMETIYSVAKVCRKDTDCRALDPDLTDTMATSRDYDELLNTWKGWR
DASGKKIRSHYKRYVELSNKAARLNGHADNGAFWRSLYETPTFETDLENIWHQLQPLYFN
LHAYVRRALYKKYGETHINLKGPIPAHLLGNMWAQSWANIFDLVMPFPEATKVDATPAMK
RQGWTPKKMFEQSDSFFRSLGLIPMPPEFWNKSMLEKPSDGREVVCHASAWDFYNRKDFR
IKQCTVVNMDDLITVHHEMGHVQYFLQYKDQPISFRDGANPGFHEAIGDVMALSVSTPKH
LYSIKLLDHMEDNLEGDINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRISNDEYNQQWW
NLRLKYQGLCPPMPRSEEDFDPGAKFHIPANVPYVRYFVSFVIQFQFHQALCKASGHTGP
LYKCDIYQSKEAGKILANALKLGFSRPWPEVMQLITGQSNMSAEALLTYFEPLTNWLIEK
NLQNNETLGWPEYTWKPYTGESDVSFLGMSLNRSQIEAGQWILLAIGLILLITTIVLGVK
YFITRRKGLRSNSEMELK
NT seq 3837 nt NT seq  +upstreamnt  +downstreamnt
atgcctccggtggcgggatttttcctctcggtctgctttggggtggcattcgccttggat
gcctccctgatgcctcctaattacaacaacaccgaggaaggggcccgcctgttcgccaaa
gactataacagcaccggggaaactgtgttcttcgaaagcgtctccgccagctggaattac
aacaccaacctgacagacgagaacgctcagctgcaggtagcagcttctttgaaggaacaa
aacttcacagaactctgggggaaaaaagctaaggagaattatggccacaactggcagaac
ttcaaggatcctcaactgaagaaaataatcagctccattcagaccctgggcccttccaat
ttaccaatgaacaagcgacacgagtataatactgttctgagtgagatggacaacatctac
tccacttccaaggtttgtccaccaaaccagagctccagctgctgggccttagagccagat
attacagacattatggccacttctcgtagttacaggaagttgctgtatgcctgggaaggg
tggcacaattctgctggcaatcctctgagatccaagtatgagaaatttgtttcactgagc
aacgaagcctataaaatggatggattccaagataccggggcttattggcggtcctggtat
gattcaccaacatttgaggaagatctagagcaactctatcaacagctggaacctctctat
ctaaatctgcatgcatttgtcaggaggaaactatatgagcaatatggttctaaatacata
aacctgaaaggccctattccagctcacttattgggtaacatgtgggcccaacaatggaac
aacatttacgacatgatggtgccttttgcaaataagccaaatctagatgttaccaacgtc
atgaagcagaaaaactggaacgtaacagtcatgttccgggtggcagaggagttcttcacc
tcgcttggcatgcttggaatgccacctgaattctgggagaaatccatgctggagaaacca
acagatggacgggaggtggtgtgccatgcatcggcatgggacttcttcaatcgcaaagac
ttcaggataaagcagtgtacaacagtcaccatggagcaactctttacagtacaccatgaa
atgggacatgttgaatactacttgcagtataaggaccagcccatcagcttccgcagtggg
gccaatcctggctttcatgaagccattggagatgtcatggccttgtctgtttccaccccc
atccacctcaagaaaattggactgctcacccatgccagtgaagataaagagagtgacatc
aattatcttctgaaaatggccctggaaaagattgccttcctaccctttggctacctaata
gaccagtggcggtggaatgtcttcagtgggcacacccctccaagccgttacaattatgat
tggtggtacctaagaacaaaataccagggaatttgtcctcctattgcaagaaatgaaaca
aactttgatcccggtgctaaataccacatccctggcaacacaccttacatcaggtacttt
gccagttttattctacaattccagttccacaaggccctttgccaagctgccaaccatact
ggcgatcttcatacctgcgatatctataactccaaagaagctggaaagaaactcagtgag
gcactgaaggctggatcttcccggccttggcaagatattctccaacaactcactggtaca
aataagatggatgcttcggcattgcttgaatactttgaacctgttactcaatggctgaaa
gaacagaataagaagaccaatgaaacactgggctggccagaatttgattggcgtcctcct
gtccctgagggctatccagaaggccttgataaaataactgatgaagctgtggctaaagca
ttcttagaagagtataacagcacagctgaagtggtgtggaatgcttacacagaggcctct
tggacgtacaatgtcgacattaatgaacacaacaaacagattatgctagagaagaatctt
gcaatgtcaaaccatactctgcaaaatggtttaaaggctcggcagtttgattccactgat
ttcaaagatcccagcataaaacgtattctgaagaaattaagtgatattgagcgggcagcc
ttacctgaagcagagctgaaggagtataatcaactgctgtcagaaatggagacaatttat
agtgtagccaaagtctgcagaaaagacacagactgcagagcactagatcccgaccttacc
gataccatggctacatcaagagactacgatgagcttcttaacacctggaaaggctggcgg
gatgcatcagggaagaaaatccgaagccactacaagagatatgtagagctaagcaataag
gctgccagattaaatggacatgcagacaatggtgctttctggagatccctttatgaaact
ccaactttcgaaactgacctggagaacatctggcatcagcttcaaccattatacttcaat
ctgcatgcttatgtacgtcgggctttatacaaaaagtatggagaaacgcacatcaatctc
aagggtccaattccagctcatttgctaggtaacatgtgggcacaatcatgggcaaacatc
tttgaccttgtcatgcccttccctgaagctaccaaagtggatgctacaccagccatgaaa
cgtcagggctggaccccaaagaagatgtttgaacagtctgatagtttcttcagatcactg
ggacttatccctatgccacctgagttctggaacaagtctatgttggaaaagccatcagat
gggagggaagtggtctgtcatgcttcggcctgggacttctacaaccgcaaggactttagg
ataaaacaatgcactgttgtgaatatggatgatttaataacagttcaccatgaaatggga
cacgtccaatactttttgcagtacaaagaccagcccatttcatttcgtgatggggccaat
ccaggattccatgaagccattggcgatgttatggccttatcagtatcaaccccaaagcac
ttgtatagcatcaagctgcttgatcatatggaagacaaccttgagggtgacatcaactac
ctgatgagcattgcactggataagattgctttcctgccctttggctacctgatggaccaa
tggaggtggaaagtgtttgatgggcgtatttcaaatgatgagtacaaccagcaatggtgg
aatcttagattgaaataccagggtttatgtcctcctatgccaagatcagaagaagatttt
gacccaggggcaaaattccacatccctgctaatgtcccatatgtcaggtactttgtcagt
tttgtaattcagttccagtttcaccaagctctgtgcaaagcttccggccatactggacct
ttatacaaatgtgacatttaccagtctaaagaagctgggaaaatcctagcgaatgccttg
aagctgggcttcagcaggccgtggcctgaagtcatgcaacttatcacaggacaatccaac
atgtccgctgaagctttgctgacctattttgaaccactgacaaactggcttattgaaaag
aacttgcaaaataatgaaactctgggctggcctgaatacacctggaagccatatacaggt
gaatcagatgtcagtttccttgggatgtcgctgaaccgcagtcaaatagaagcaggacag
tggatcttgcttgcaattgggcttatccttcttattaccacaatagtcttgggtgtcaag
tacttcataacaaggaggaaaggcctcagatctaactcagaaatggaactgaaatga

DBGET integrated database retrieval system