KEGG   Paracoccidioides lutzii Pb01: PAAG_03011Help
Entry
PAAG_03011        CDS       T02230                                 

Definition
(RefSeq) histone-lysine N-methyltransferase
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PAAG_03011
Enzymes [BR:pbl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PAAG_03011
Chromosome [BR:pbl03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     PAAG_03011
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    PAAG_03011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 474 aa AA seqDB search
MVIDLTRDSSSEDDPRHGVEPEIRTPPHDEGLTLLQKFTRPSLRPGSSSSGGTMRNEWKS
TASTNGAISSTLNGVLPSNKPPQPSFAVVVPSLGCDTGIKRRRLSSEDDSSSQANGVDPE
FPNHHGLSSFYSVERRSKALTYQPKQEVSRNRANIQIKQPAVRYHPFQKGHSDKDILSLY
LKKLQRIQGPPVTLKIDPSDASNIDFNFEFINEYKLQKGVKRVDPGFHVGCQCVGVCDSS
SCYHLDRLPNEDEDEDEVSEHQIIPYQVGRDGKVVLRHEFFRKRAMIYECSPLCTCLPSC
LNRVVQKGRTLKLEIFRTDNRGFGLRSPENIQAGQYIDRYLGEVITRKEADAREAATPKN
SASYLFQLDFFISAEENCYIVDGRKYGSITRFMNHSCRPNCRMFPVSQYEAERNIFDMAF
FAIKNIPAGTELTFDYCPYSDKEGSKAVDPDAVKCLCGERTCRGQLWPNQRKTM
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggttattgaccttacaagagattcgtcctcagaagatgaccctcgacacggcgttgaa
ccagaaatccgcactccacctcatgatgaagggcttacccttctacaaaaattcacacgt
ccgagcctacgaccagggagtagttcaagcggagggacaatgcgaaatgagtggaaaagt
acagcatctacaaacggcgcaatttcgagtactttgaatggtgtgctacctagcaacaag
ccaccccaaccctccttcgcggtcgtagtgccatccttggggtgtgatactggtattaaa
aggagacgcctgagctctgaagatgacagtagtagccaggctaatggagttgatcccgaa
tttccgaatcatcatgggctatcgtctttctactccgtggaacggagaagcaaagctttg
acctaccaacctaagcaggaagtcagtcggaatcgggccaacattcaaataaaacagcct
gctgtgcgctatcacccttttcagaaaggccactcagacaaggacatattgtcactctac
ttgaaaaagcttcagcggattcaagggccccctgtgacattaaagatagatccctccgac
gcctcaaacattgacttcaactttgagttcattaatgagtacaagcttcagaagggggtt
aaacgcgttgacccaggtttccatgtcggctgtcagtgtgtcggtgtctgtgattcatcc
agctgttatcacctggatcgcctccctaacgaggacgaggatgaagacgaagtctcggaa
catcaaattataccttatcaagtggggcgggatggaaaagttgttctgaggcatgaattc
ttcaggaaaagggcaatgatttatgaatgttcccctctctgtacttgtcttccaagttgt
ttgaatcgggtagtacagaaaggccggacacttaaattggagattttccgaacagataac
cgtggttttggtctacgttccccagaaaacatccaagctggacagtacattgataggtat
ctgggcgaagtgataacaaggaaagaagctgatgcccgagaagctgcaactcccaaaaat
tctgccagctacctatttcaactagacttcttcatttcagcagaggaaaattgctacata
gttgatggaagaaaatatggctccatcacgcgcttcatgaaccattcctgccgccctaat
tgcaggatgttccctgtctcccagtatgaagctgaacggaatatctttgacatggccttc
tttgctatcaagaatattccagcagggactgagctgacttttgactactgcccttattcc
gataaggagggttccaaggcagtcgatcctgatgcggttaagtgtttgtgtggggaacgg
acatgccgtggtcagttgtggccgaaccaacggaaaacaatgtag

DBGET integrated database retrieval system