KEGG   Paracoccidioides lutzii Pb01: PAAG_03506Help
Entry
PAAG_03506        CDS       T02230                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
pbl00250  Alanine, aspartate and glutamate metabolism
pbl00410  beta-Alanine metabolism
pbl00430  Taurine and hypotaurine metabolism
pbl00650  Butanoate metabolism
pbl01100  Metabolic pathways
pbl01110  Biosynthesis of secondary metabolites
Module
pbl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PAAG_03506
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAAG_03506
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PAAG_03506
   00430 Taurine and hypotaurine metabolism
    PAAG_03506
Enzymes [BR:pbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PAAG_03506
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DegT_DnrJ_EryC1 CCDC-167
Motif
Other DBs
NCBI-GeneID: 9098063
NCBI-ProteinID: XP_002794961
UniProt: C1GXD2
LinkDB All DBs
Position
Unknown
AA seq 516 aa AA seqDB search
MVHLAAIRRESVVLPTRPIQRIETIPLEEPQEHDFFSSVYGSRFAAEDLPTLEMPEKEMP
KEVAYRMIKDELSLDGNPMLNLASFVTTYMEEEAEKLMSESFSKNFIDYEEYPQSAEIQN
RCVNMIARMFNAPGEDSEEHAMGTSCVGSSEAIMLGTLAMKRRWQNKRKAEGKDCSNPNI
IMSSAVQVCWEKAARYFEIEEKFVYCTSDRYVIDPEEAVNLVDENTIGICAILGTTYTGQ
YEDVQRINDLLVERGIDCPIHVDAASGGFVAPFVNPNLEWDFRLEKVVSINVSGHKYGLV
YPGVGWIVWRSPEYLPKELVFNINYLGAEQTSFTLNFSKGASQVIGQYYQMIRLGKRGYR
NIMINLTRTADYLSSVLKELGFIIMSDGSGHGLPLVAFHLSSDQGYEFDEFALAHQLRER
GWVVPAYTMAPHSEQLKLMRIVVREDFSRSRCDLLLADIKLALEQLSEMDRKAMEKYQHH
IRQHVSNVGKATHNHPHYQDEDHSLQGKSGKTHAIC
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggttcatctcgcagcaatccgaagggaatcagttgtccttccgactagaccgattcag
cgtatcgaaaccattccccttgaggagcctcaggaacatgacttcttctccagcgtctat
ggctctcggttcgcggcagaggacttgcctacactcgagatgccggagaaagaaatgccc
aaggaggtggcgtatagaatgatcaaggacgagttgagcctggacgggaatcctatgttg
aacttggcgagttttgttaccacatacatggaggaggaagccgaaaaactcatgtctgaa
tcgttcagcaagaacttcattgactacgaggaatatccacagtctgcagagattcagaac
cgctgcgtcaacatgattgctcgcatgttcaatgctcctggcgaagattcggaagaacat
gccatgggaacctcgtgcgtaggttcttccgaagccatcatgctggggacgctcgctatg
aaaaggcgctggcaaaataaaagaaaggcagaaggaaaagattgttccaatcccaacatt
attatgagcagcgctgttcaggtatgttgggaaaaggcagctagatattttgaaattgag
gagaaatttgtctactgcaccagtgatagatatgttattgatccagaagaggctgttaat
ctcgtggatgagaataccattggtatttgtgcaattttaggcaccacatacactggccag
tatgaagatgtgcagaggattaacgatcttcttgtcgaacgtggaatcgattgtcccatc
catgtcgacgcagcaagcggtggatttgtggcaccctttgtaaacccgaatttggaatgg
gatttcagacttgagaaggttgtttctataaatgtctctggacacaaatatggactcgta
tacccgggtgttggctggattgtttggcgttctccggaatatctccccaaggagctagtt
ttcaacattaactatcttggggccgaacaaaccagctttaccctcaacttctccaagggc
gcatcgcaagttatcggccaatattatcaaatgatccgccttgggaaacgcggctaccgc
aatataatgatcaatctcacgcgcaccgcggactatctctcctcagtgctgaaagaatta
ggtttcatcatcatgagcgacgggagtggccatggtctacctcttgtagccttccatcta
tcttctgaccagggctatgagtttgatgagtttgcgctggctcaccagttgcgggaacgc
ggctgggtcgttcctgcatataccatggccccgcatagtgagcagttgaaactcatgcgt
attgtggttcgagaagactttagcagaagtcgttgcgatttgttgctggctgatatcaaa
cttgcattggagcagctgagtgagatggaccgaaaagctatggagaaatatcaacaccat
atccgccaacacgtttccaacgtcggcaaggcaactcataatcacccccattaccaggat
gaagaccactccctacaaggaaagtcagggaaaactcacgctatctgctaa

DBGET integrated database retrieval system