KEGG   Paracoccidioides lutzii Pb01: PAAG_07276Help
Entry
PAAG_07276        CDS       T02230                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
pbl  Paracoccidioides lutzii Pb01
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAAG_07276
Enzymes [BR:pbl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     PAAG_07276
Glycosyltransferases [BR:pbl01003]
 Polysaccharide
  Storage polysaccharide
   PAAG_07276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 708 aa AA seqDB search
MSSPHTPKRDIKNHVLFEIATEVANRVGGIYSVLKSKAPVTTAEYGERYTLIGPLNRSSV
EVEVEELTPTDPHIAATIASMKERGVDMIYGRWLIEGAPRVILIDTGAGYKYLDEWKGDL
WNAAGIPSPAEDSESNEAIVFGYLVAWFLGEYISRDRTRAVVAHFHEWLAGIALPLTKKR
HMDVTTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDAEAGKRGIYHRYCIERAAAHSADV
FTTVSHITAFESEHLLKRKPDGVLPNGLNVKKFAAVHEFQNLHSHAKDKINDFVRGHFYG
HNDFDLDNTLYFFIAGRYEYRNKGVDMFIESLARLNHQLKTSGLTTTVVAFIIMPAQTSS
LTVEALKGQAVVKSLRDTLEMVEQGIGKRLFERCLSWKEGDNMPDEKDLITNQDRVLLRR
RLFAMKRHQLPPIVTHNMINDAEDPVLNQLRRVQLFNHPSDRVKVVFHPEFLNSSNPVLP
LDYDDFVRGTNLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCYMEELIENSSDYGI
YIVDRRMKGVDESVNQLTNFMFEFACKSRRQRINQRNRTERLSDLLDWKRMGMEYVKARQ
LALRRAYPSSFDPAEDFSDIIGGTEQKISRPFSVPGSPRDRTGMMTPGDFASLQEGREGL
STEDYIAWKLPEEEDADEYPFPLTLRKKATTGIPPHSPEREVTANGDV
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcccgcatactccaaaacgagatatcaagaaccatgttctatttgaaattgca
acggaagttgcaaaccgggttggcggaatatactctgtcctaaagtccaaggcgccggtt
acgactgcagagtatggcgaaagatacacactcatcggccctctgaatcgctcatcggtc
gaggtcgaagtcgaggaacttaccccaaccgatcctcatattgccgccacgattgcctct
atgaaagaacggggcgttgatatgatctatgggcggtggctgatcgagggggcgccgaga
gtaatcctaattgacacgggtgcgggatacaaatacctggacgagtggaagggtgatctt
tggaatgcggccggaatcccgtctcctgcggaggatagtgagtcgaatgaagctatcgtt
ttcggctatttagtagcttggttccttggtgagtatatctccagagatagaactcgagct
gttgtcgcgcatttccacgagtggctagccggtattgcccttcccttgaccaagaagcgg
catatggacgtcacaaccattttcacgacccatgcaacactcctaggtagatatctgtgc
gccggatctgtcgatttttacaacaacctacaatacttcgacgttgacgctgaagccggg
aaaagagggatctaccaccgatactgcattgaacgcgctgctgcgcattcggcagatgtg
ttcacaacggtgtcacacatcacagcgttcgagagcgagcatcttctgaaacggaagccc
gatggtgtgttgcccaacggacttaacgtgaagaagtttgctgcagttcacgagttccaa
aatcttcattcccatgccaaagacaagatcaatgactttgtccgtggccatttctatgga
cataacgactttgatctcgataatactctatacttcttcattgcaggtcgttatgagtat
cggaacaagggggtggatatgtttatcgaatctctcgcgagactgaatcatcaactcaaa
acatctggcttaactactaccgtagtcgcattcattatcatgcctgcacagacatcgtcg
ctcacagttgaggccctcaaaggccaagccgttgtaaaatctcttcgcgacacactagaa
atggttgagcagggaattggaaagcggctattcgagcgttgtttgagttggaaggaagga
gacaatatgcccgatgaaaaggatttaatcacaaaccaggaccgggtactcctgcgccgt
cgactattcgcaatgaagcggcatcagcttccacccatcgtgacacataacatgataaat
gacgcagaagacccagtgctgaaccagctacgccgtgtccaactcttcaaccacccgtcc
gatcgtgtcaaggtggttttccaccccgaatttctcaattcatcaaacccagttttgccc
ctcgattacgacgattttgtccgcgggacaaatctaggcgttttcccatcctattatgag
ccgtgggggtacacccctgcggagtgcacggttatggggatacccagcataaccaccaac
ctctctggattcggatgttacatggaggaactcatagaaaactcgtcggattacggcata
tacattgtcgaccggcgcatgaagggtgtggatgaatccgtgaaccagcttacgaacttt
atgtttgaatttgcgtgcaaaagccgacggcaacgtatcaatcagcgcaatcggacggag
cggctaagtgatttgctcgactggaagaggatgggtatggagtatgtcaaagcgcggcag
ctggcgcttcgaagagcatatccgtcctcctttgaccccgcggaggacttcagcgatatc
atcggaggaacagagcagaagatttcccgcccgttctctgtacctggttctcctcgcgat
cgaacgggaatgatgacccctggtgactttgcgtcgttgcaggagggtcgcgagggtttg
agtacggaagattatattgcctggaagctacctgaggaggaagatgcggacgaatatccg
ttcccacttacgttgcgaaagaaagctactacgggtatccctccgcactccccagagagg
gaggtaacggccaacggtgacgtgtag

DBGET integrated database retrieval system