KEGG   Paracoccidioides brasiliensis Pb18: PADG_03813Help
Entry
PADG_03813        CDS       T03549                                 

Definition
(RefSeq) hexokinase
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PADG_03813
   00051 Fructose and mannose metabolism
    PADG_03813
   00052 Galactose metabolism
    PADG_03813
   00500 Starch and sucrose metabolism
    PADG_03813
   00520 Amino sugar and nucleotide sugar metabolism
    PADG_03813
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PADG_03813
Enzymes [BR:pbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     PADG_03813
Membrane trafficking [BR:pbn04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    PADG_03813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 476 aa AA seqDB search
MADMPTELLDQLKTLEELFTVDQAKLKKIVDHFVKELEKGLSVDGGNIPMNVTWVLGFPT
GYEQGTYLSLDMGGTNLRVCEIHLTEEKGEFDITQSKYRIPDELKNGSSEDLWEYIADCV
QQFIEHYHEGDISIPDFPLGFTFSYPATQDYIDHGVLQRWTKGFDIDGVEGHDVVPMLEA
ALAKKNLPTKITALINDTTGTLIASAYTDPEMRIGCIFGTGVNAAYMENAGSIPKIAHYN
LPPDTPVAINCEYGAFDNDHIVLPLTQYDIIIDRDSPRPGQQAFEKMTAGLYLGEIYRLV
LLDLIDNKDNLIFPNQDVSGLRKPYSLDSSFLSYIEEDPFENLSETRDLFQRKLGIYSSS
SELEFCRRLAELIGTRAARLSVCGVAAICKKKNISHCHVGADGSVFNKYPHFKARGAKAL
REILDWPDNEPDRIVMSGAEDGSGVGAALIAALTLERVKKGNLVGIQNKETITKFC
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggctgatatgccaacggagttgctggaccagctcaaaacattggaggaactctttacg
gtggatcaggcaaaactaaagaagatcgttgaccattttgtcaaggagttagagaagggc
ctaagtgtcgatggaggaaacattcctatgaacgtaacatgggtcttggggttccccact
ggctatgagcaaggcacatacctctccctcgatatgggcggtaccaatctacgagtttgt
gaaattcacctcaccgaagagaagggcgagttcgatatcacacaatccaagtaccgaata
cccgatgagctgaagaacggaagctcagaagacctctgggagtatattgccgactgcgtg
cagcagttcatcgaacattaccatgaaggcgatatatccatcccggatttcccattgggc
ttcacgttctcctaccccgccacgcaggattatattgatcatggagtcctgcagaggtgg
accaagggctttgatatcgatggggtggagggccatgatgttgttccaatgttagaagca
gcattggctaagaagaacctcccaactaagatcaccgctctaatcaatgacacaaccggc
actctcatcgcctccgcttataccgatcccgagatgagaatcggttgtatattcggcact
ggcgtcaacgctgcttacatggaaaacgccggttccatccccaaaattgcccactacaac
ttacccccggacacccctgtggccatcaactgcgaatacggcgccttcgacaacgatcac
atcgtcctccccctaacccaatacgacatcataatcgaccgtgactcaccccgaccaggc
caacaggccttcgaaaagatgaccgcaggcctctacctgggcgaaatctaccgcctcgtc
ctcctcgacctcatcgacaacaaggacaacctcatcttccccaaccaagacgtctccgga
ctgcgcaaaccctactccctcgactcctccttcctctcctacatcgaagaagaccccttc
gaaaatctctcggagactcgcgacctcttccagcgcaagctgggcatctactcctcctcc
tctgagctggaattctgccggcgcctggcggaattaatcggcactcgtgccgcgcgcctc
tccgtctgcggcgttgcggccatctgcaagaagaaaaatatctcacattgtcatgtcggc
gcggacgggtcggtgtttaacaagtatcctcatttcaaagccaggggtgccaaggcgctg
agggagattctggactggccggataatgagcctgatcggattgtgatgagtggagcggag
gatggttccggtgttggtgcggcgttgattgcggcgttgacgcttgagagggttaagaag
ggcaatttagtggggattcagaataaggagacgataacgaagttttgttga

DBGET integrated database retrieval system