KEGG   Paracoccidioides brasiliensis Pb18: PADG_07950Help
Entry
PADG_07950        CDS       T03549                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pbn  Paracoccidioides brasiliensis Pb18
Pathway
pbn00010  Glycolysis / Gluconeogenesis
pbn00051  Fructose and mannose metabolism
pbn00052  Galactose metabolism
pbn00500  Starch and sucrose metabolism
pbn00520  Amino sugar and nucleotide sugar metabolism
pbn01100  Metabolic pathways
pbn01110  Biosynthesis of secondary metabolites
pbn01130  Biosynthesis of antibiotics
pbn01200  Carbon metabolism
Module
pbn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pbn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PADG_07950
   00051 Fructose and mannose metabolism
    PADG_07950
   00052 Galactose metabolism
    PADG_07950
   00500 Starch and sucrose metabolism
    PADG_07950
   00520 Amino sugar and nucleotide sugar metabolism
    PADG_07950
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PADG_07950
Enzymes [BR:pbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     PADG_07950
Membrane trafficking [BR:pbn04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    PADG_07950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Gly-zipper_Omp
Motif
Other DBs
NCBI-GeneID: 22586338
NCBI-ProteinID: XP_010763342
UniProt: C1GKU3
LinkDB All DBs
Position
Unknown
AA seq 509 aa AA seqDB search
MSSSSSSSPVLDEARRIAAQFEYPAEELNRGVREFIREMHEGLEEEGATLRQIPTYVTAV
PEGTEKGVYLAVDLGGTNFRVCSVNLHGDSTFSICQSKVPIPSALMTTKNSADLFSFLAL
QIENFLATHQSEHFDLHIKKRQTGEITAPYTDDHIFNLGFTFSFPVDQHGINSGTLIRWT
KGFDIKEAVGKDVCKLLQDAIDERKLPVRVAALVNDTVGTLMARSYSSPGPSKALIGAIF
GTGTNGAYVEKLARVTKLDKKNGNSADAKYDRATGEMVINVEWGSFDNHLSVLPTTIFDS
DLDNDSVNPGIQMFEKRISGMFLGEILRRALLSMVKDPAVMLFNNDSAAGQNGLVTIIPA
DSDLHKQWGIDTSFLSTVEADDSPAFDTTRSQVRQEFGIENASTDDCHAVKILVHAIGKR
AARLSALALGAVIISTDRLRGDGVVDIGVDGSVVEHYPGFEGYLREAFREIEGIGENGEA
RITIGVAKDGSGVGAALGALVAGRTGSRE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcgtcctcttcctcctccccggtcctcgatgaagcccgccgcatcgctgcccag
ttcgagtatccggcggaagagctcaaccgcggcgtcagggagttcatccgggagatgcac
gaggggctggaggaggagggtgctacactgcgtcagattccgacatatgtaactgccgtg
ccagagggtacggagaagggcgtctacctagccgtagacctaggtggaaccaactttcgc
gtctgctccgtaaatctccacggagactcgaccttctccatctgccaatccaaagtcccc
atcccaagcgctctcatgaccacaaagaatagcgcagacctcttctccttcctcgccctc
caaatcgaaaacttcctcgcaactcaccaatccgaacacttcgatttacacatcaagaaa
cgacaaaccggtgaaattacagccccttacacagacgaccatatcttcaatctgggcttc
acattcagcttccccgtcgaccagcacgggattaacagcggcactctcatacgctggacg
aaggggttcgatataaaagaagctgtcgggaaggatgtctgcaagttgctgcaggacgcc
atagatgagcgcaagctgcccgtccgcgtcgcggcactggtcaacgataccgtcggcacg
ctcatggcgcgctcgtatagctcccctggcccatcgaaggcactcataggcgccatcttc
ggcacgggcacaaatggcgcctacgtcgagaagctggcgcgggtaaccaagttggataag
aagaatggtaacagcgctgatgctaaatatgacagggcgacgggtgagatggttattaat
gttgagtggggtagctttgataaccatctcagcgtcctgccaactacgatcttcgatagc
gacctagacaacgacagcgtcaacccaggtattcagatgttcgaaaagcgcatttcgggc
atgttcctaggcgagatcctgcggcgcgctctgctgtccatggtcaaggatccggctgtg
atgctcttcaacaacgattccgctgctgggcaaaacggattagtgacaatcatcccggcc
gattcagaccttcacaagcaatggggcatagacaccagcttcctcagcacagtggaggcg
gacgattcaccagccttcgataccacacgcagccaagtgaggcaggaattcggcatcgaa
aacgcaagtacagacgactgtcacgcggtgaagattctggtgcacgccattggcaagcgg
gcggcgcggttaagtgcccttgcgcttggggcggtgattatctccacagaccgactgagg
ggtgacggggtggtggatattggggttgatgggagtgttgttgagcattacccagggttt
gaggggtatttgagagaggcatttagagagattgaggggattggggagaatggggaggct
agaattacgattggtgttgcgaaggatgggagtggcgttggggcggcgcttggggcgctt
gtggcggggaggacgggtagcagggaatag

DBGET integrated database retrieval system