KEGG   Phycisphaerae bacterium L21-RPul-D3: L21SP3_00913Help
Entry
L21SP3_00913      CDS       T04695                                 

Gene name
nedA_3
Definition
(GenBank) Sialidase precursor
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
pbu  Phycisphaerae bacterium L21-RPul-D3
Pathway
pbu00511  Other glycan degradation
pbu00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pbu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    L21SP3_00913 (nedA_3)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    L21SP3_00913 (nedA_3)
Enzymes [BR:pbu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     L21SP3_00913 (nedA_3)
Bacterial toxins [BR:pbu02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   L21SP3_00913 (nedA_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR Sortilin-Vps10 B3
Motif
Other DBs
NCBI-ProteinID: AQQ09113
UniProt: A0A1Q2HPF5
LinkDB All DBs
Position
complement(1188416..1189564)
Genome map
AA seq 382 aa AA seqDB search
MTFKNYFCLFMFVVSVAVFAEGNDKNEIEYTDLFVRHENGYNTYRIPSIIRTNKGTLLAF
CEGRKDGVGDEGDIDLLMKRSEDNGESWSKQVVIWDDGDNTCGNPCPVVDRQTGTIWLGL
TWNYGSDHLKGIVAGESKHPRIPYISKSEDDGLTWTKPNNISDSVRRDYWRWYATGPGTG
IQLKYGKKKGRLVIPANHTISCEYKKFQQGAHVIYSDDHGKTWKLSDVARPGLNESQVVE
LLDGKVLLNSRNSRYRGSRALSFSTNCGETWDYVSYKSNLNEPTCQASIIRYAPNKNNDK
DIILFSNPDSKKRTNMTVRVSYDGAKTWSHKRTIHEGPAAYSSLTVLDNGKIACLYEGGK
GFRYSKIIFSKFTLDWIIDGKK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaagaattatttttgtttgtttatgtttgtagtatctgttgctgtttttgca
gaaggtaatgataaaaatgagattgagtacactgatctttttgtgaggcacgagaacggc
tataacacttacagaattccttcaattataagaacaaataaaggtactctattagccttt
tgtgaaggaagaaaggatggtgtgggagatgaaggtgatatagatttgttaatgaaacga
agcgaggataatggtgagtcttggtctaagcaggttgtaatatgggatgatggcgataat
acttgtggaaatccttgtccagtagtagatagacaaactggcactatttggcttggttta
acatggaattacggcagtgatcatttaaagggaattgttgcaggggaaagtaagcatcct
cgtattccttatattagtaaatctgaggacgatgggcttacgtggacaaaacctaataat
atcagtgattctgtccgtcgagattattggagatggtacgctacaggacctgggactgga
atacaactcaagtacggcaagaagaaaggtcgtttggttataccagcaaaccacacaatt
agctgtgagtacaaaaagtttcaacagggggcgcatgtaatatacagtgatgatcatggc
aagacatggaaactcagtgatgttgcacgccctggattgaatgaaagtcaggtggtagag
cttcttgatgggaaggttttgttgaattctcgcaactcacgttacaggggcagcagggcc
ttgtcattcagcactaattgcggagaaacttgggactatgtgtcatacaaatctaatctc
aatgaaccaacttgtcaagcaagtattataaggtatgccccaaataagaataatgataag
gacattattttgttctccaatcctgactctaaaaagcgtaccaacatgacagttagagtt
agttatgatggagcaaagacttggagtcataagagaaccattcatgaaggaccagcggct
tattcatctctaaccgtattagataatggtaagatagcttgtttgtatgagggtggcaaa
ggttttagatattcaaagataattttttcaaaatttacacttgattggattattgatggg
aagaaataa

DBGET integrated database retrieval system