KEGG   Paenibacillus bovis: AR543_09870Help
Entry
AR543_09870       CDS       T04407                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pbv  Paenibacillus bovis
Pathway
pbv00020  Citrate cycle (TCA cycle)
pbv00480  Glutathione metabolism
pbv01100  Metabolic pathways
pbv01110  Biosynthesis of secondary metabolites
pbv01120  Microbial metabolism in diverse environments
pbv01130  Biosynthesis of antibiotics
pbv01200  Carbon metabolism
pbv01210  2-Oxocarboxylic acid metabolism
pbv01230  Biosynthesis of amino acids
Module
pbv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbv_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pbv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AR543_09870
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AR543_09870
Enzymes [BR:pbv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AR543_09870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ANF96279
UniProt: A0A172ZFH3
LinkDB All DBs
Position
2334153..2335448
Genome map
AA seq 431 aa AA seqDB search
MPNFEKYELPTAGEQIKIEDGKLQVPNNPIIPFIEGDGTGRDIWKASVRVLDAAVEKAYG
GSKKIAWYEVFAGEKAFNTYGEWLPADTLEAIREYTVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCLRPVRYFDGVPSPVKRPELVDMVIFRENTEDIYAGIEYQEGTEEVKKVLEFLK
NEMGVNKIRFPETSGIGIKPVSEEGSKRLVRAAVQYAVDHGRKSVTLVHKGNIMKFTEGA
FKNWGYEVAEAEFGDKVFTWAQYDKIKDEQGTDAANAAQKAAEDAGKIIVKDAIADIALQ
QVLTRPAEFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKY
ADKDVVNPGSVILSGVMMLEHLGWQEAADLIYKGLETSINNKTVTYDFARLMDQATEVKC
SEFADKVIENM
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccgaactttgaaaaatacgaactgccaactgccggtgagcagatcaagattgaagat
ggaaaattgcaggtgcctaacaacccgatcattccttttatcgagggtgacggtacagga
cgcgacatctggaaagcttctgtacgtgtgctggatgcagccgtagaaaaagcatatggc
ggctccaaaaaaatcgcctggtatgaagtatttgccggtgaaaaagcattcaatacatac
ggagaatggctgccagccgatacgctggaagcaatccgtgaatatacagtagcgatcaaa
ggaccactgactacgccaatcggcggcggtatccgttccctgaacgttgctctgcgtcag
gaactggatctgtatgtatgtctgcgtcctgtacgttactttgacggtgtaccttctccg
gtaaaacgtcctgagctggtagatatggttatcttccgtgagaacaccgaggatatctac
gcaggtatcgagtatcaagaaggtacagaagaagtgaaaaaagtactggaattcctgaaa
aacgaaatgggcgttaacaaaatccgcttcccggaaacttccggtatcggtatcaaaccg
gtatccgaagaaggttccaagcgtctcgttcgtgccgcggtacaatacgcagtcgatcat
ggccgtaagagcgtaacgctggtacacaaaggtaacatcatgaaatttaccgagggtgct
ttcaaaaactggggttacgaagtggctgaagctgaattcggcgacaaagtattcacatgg
gcacaatacgataaaatcaaagacgagcaaggtacagacgctgccaatgctgcacaaaaa
gcagcagaagatgctggcaaaatcatcgtaaaagatgccatcgccgatatcgcgctgcag
caagtactgacacgtccggctgaatttgatgtgatcgctacactgaacctgaacggtgac
tatctgtccgatgcactggctgcacaggttggtggtatcggtatcgctccaggcgctaac
atcaactatgtaacaggtcatgcaatcttcgaagcaacgcacggtacagctccgaaatat
gcagacaaagacgtagtaaacccgggttctgttattctgtccggcgttatgatgctggag
catctgggctggcaagaagcggctgacctgatctacaaaggtctggaaacgtcgatcaac
aacaaaaccgttacttacgatttcgcacgtctgatggatcaagcgaccgaagtgaaatgc
tccgagtttgccgacaaagttatcgaaaacatgtaa

DBGET integrated database retrieval system