Physeter catodon (sperm whale): 102988466 Help Entry 102988466         CDS       T06011                                  Symbol CXCL14 Name (RefSeq) C-X-C motif chemokine 14   KO K10033   C-X-C motif chemokine 14 Organism pcad  Physeter catodon (sperm whale) Pathway pcad04060   Cytokine-cytokine receptor interaction pcad04061   Viral protein interaction with cytokine and cytokine receptor pcad04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     102988466 (CXCL14)    04061 Viral protein interaction with cytokine and cytokine receptor     102988466 (CXCL14)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     102988466 (CXCL14)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pcad04052]     102988466 (CXCL14) Cytokines and neuropeptides [BR:pcad04052]  Cytokines   Chemokines    102988466 (CXCL14) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 DUF6355 NinB Motif Other DBs NCBI-GeneID:  102988466 NCBI-ProteinID:  XP_007101455 Ensembl:  ENSPCTG00005011924 UniProt:  A0A2Y9EGK0 LinkDB All DBs Position 8:complement(132159641..132166823) Genome browser AA seq 99 aa AA seqDB search MRVLTAALLLLLLALCAARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITT KSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgagggtcctgacggcagcgctgcttctgctgctcctggcgctgtgcgccgcgcgcgtg gatgggtccaaatgcaagtgctcccggaagggacccaagatccgctacagcgacgtgaag aagctggaaatgaagccaaagtacccgcactgcgaggagaaaatggttatcatcaccacc aagagcgtgtccaggtaccggggtcaggagcactgcctgcaccccaagctgcagagcacc aagcggttcatcaagtggtacaacgcctggaatgagaagcgcagggtctacgaagaatag

DBGET integrated database retrieval system