KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_001730Help
Entry
PCC21_001730      CDS       T02320                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase 2, LaPEPC2 (ISS)
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC21_001730
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCC21_001730
  Energy metabolism
   00680 Methane metabolism
    PCC21_001730
Enzymes [BR:pcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PCC21_001730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(186980..189619)
Genome map
AA seq 879 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKEALGENILDKVETIRKLSKSSRAGNEKHRQELLTTL
QNLSNDELLPVARAFSQFLNLTNTAEQYHTISPHGEAASNPALLSNAFERLKESKNLTER
DIRDAVESLSIELVLTAHPTEITRRTLIHKLVEVNTCLKQLDHNDLADYERNQIMRRLRQ
LIAQSWHTDEIRKIRPTPVDEAKWGFAVVENSLWEGVPAFLRELDEQLEQAFGYRLPVDA
VPVRFTSWMGGDRDGNPNVTAEVTRHVLLLSRWKAADLFLRDIQVLVSELSMSECTPELL
ELAGGSEVQEPYRAIMKSLRSQLSSTLSYLEARLTGEERLPPKDLLVTNEQLWEPLHACY
QSLKTCGMGIIADGRLLDTLRRVRCFGVPLVRIDVRQESTRHTEALAEITRYLGLGDYES
WSESDKQAFLIRELSSKRPLLPRYWEPSADTKEVLDTCRVIAKAPIGSVAAYVISMARTP
SDVLAVHLLLKEAGCPFALPVAPLFETLDDLNNADDVMKQLLSIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYRAQDALIKTCEKAGIALTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLALYTGAILEANLLPPPEPKQEWHEVMDEL
SRVSCDMYRGYVRENPDFVPYFRAATPELELGKLPLGSRPAKRRPNGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVDDGKQEQLEAMCRDWPFFSTRIGMLEMVFAKADLWLAE
YYDQRLVEEKLWPLGKQLRDQLAADINVVLAISNDDHLMADLPWIAESIALRNVYTDPLN
VLQAELLHRSRQQEKPDADLELALMVTIAGVAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgcagtaacgtcagtatgctcggcaagcttctcggc
gataccatcaaggaagcgctgggtgaaaacatccttgataaagtcgaaacaatccgcaag
ctgtcaaagtcttcccgcgcaggtaatgaaaaacatcgtcaggagctgctgaccacgctg
caaaacctgtctaacgatgaactgttgcccgttgcccgtgcattcagccagttccttaac
ctgaccaataccgccgagcaataccatacgatttcaccgcacggtgaagcggcgagtaac
ccggcactgctttccaacgcctttgagcgtctgaaggaaagcaaaaatctgaccgaacgc
gatatccgtgacgccgtggagtccttgtcgatcgagctggtgctgaccgcgcacccgacc
gaaattacccgtcggacgctgatccacaaactggtggaagtgaatacctgcctcaagcag
ctcgaccataacgatctggctgattatgaacgtaatcagatcatgcgccgcctgcgccag
ctgatcgcacagtcctggcataccgatgaaatccgtaaaattcgtcctaccccggtagat
gaagccaaatggggctttgccgtggtggaaaacagcctgtgggaaggcgtgcctgcgttt
ttacgcgagctggatgaacagctggaacaggcttttggctaccgtctgcccgttgatgcg
gttccggtacgctttacgtcttggatgggcggcgaccgcgacggtaacccgaacgtcacg
gcggaagtcactcgccatgtgctgttactcagccgttggaaagcagccgatctgttcctg
cgtgatattcaggtgctggtttccgagctgtcgatgtccgaatgtacgccggagctgctg
gagctggccggcggcagcgaggtacaggaaccgtaccgcgccatcatgaagtcgctgcgt
tcgcagttgagcagtacgctgagctatctggaagcacgtctgacaggtgaagagcgtctg
cctcctaaagatctgctggttaccaacgaacaactttgggaaccgctccacgcctgctat
cagtcgctgaaaacctgcggcatgggcatcatcgccgatggtcgtctgctggatacgctg
cgtcgcgtgcgctgcttcggcgtgcctttggtacgcatcgatgtccgtcaggaaagtacc
cgccacaccgaagcactggccgaaattacccgctatctgggtctgggcgactacgaaagc
tggtcagagtcggataagcaagccttcctaatccgtgaactgagctctaagcgcccgctc
ctaccgcgctactgggagccgagtgcggataccaaagaggtgctggatacctgtcgtgtc
atcgccaaagcgccaatcggttcagtcgcagcctatgtcatttcaatggcacgcacacct
tccgacgtgctagccgttcacctgctgctcaaagaagcgggctgcccgtttgccttgccg
gtcgcgccgctgtttgaaacgctggacgacctgaacaacgccgatgatgtcatgaaacag
ttgctgagcatcgactggtatcgcggctttatccaaggcaaacagatggtcatgatcggc
tattccgactccgcgaaagacgcgggcgtgatggccgcttcctgggcgcaatatcgtgca
caggacgcactgatcaaaacctgtgagaaagcgggtatcgcactgacgctgttccacgga
cgcggcggttccatcggtcgcggtggcgcaccggctcatgctgcgctgttgtcacaaccg
ccgggtagcctgaaaggtggcctgcgcgtgacggaacaaggcgagatgatccgctttaag
tacggcctgccggaagtcaccatcagcagcctggcgctgtataccggtgcgattctggaa
gcaaacctgctgccgccgccggagccaaaacaggaatggcacgaggtgatggatgagctg
tcccgcgtgtcctgcgatatgtaccgtggctacgtgcgtgagaacccggatttcgttcct
tacttccgcgccgctacgccggaactggagctgggtaaactgccgctggggtcacgtccg
gccaagcgtcgtccgaacggcggtgtggaaagcctgcgtgctatcccgtggattttcgcc
tggacgcagaaccgtctgatgctgccagcgtggctgggtgcaggtgccgcgttgcagaaa
gtggtggatgacggtaagcaggaacagctggaagccatgtgtcgcgactggccgttcttc
tcgacgcgtatcggtatgctggagatggtgttcgccaaagccgacctgtggctggcggag
tattacgatcagcgtctggtagaagagaaactgtggccgttagggaaacagctgcgcgat
cagctggccgccgatatcaatgtcgtgctggcgatctccaacgacgatcacctgatggcg
gatctgccgtggatcgccgagtcgatcgcattgcgtaacgtctataccgatcctctgaac
gtgttgcaggccgagttgctgcatcgttcacgtcagcaggaaaaaccggatgccgatctg
gagctggcgctgatggtgacgatcgccggtgttgcagcgggtatgcgtaatacgggttaa

DBGET integrated database retrieval system