KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_002040Help
Entry
PCC21_002040      CDS       T02320                                 

Definition
(GenBank) Elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Brite
Translation factors [BR:pcc03012]
 Eukaryotic Type
  Elongation factors
   PCC21_002040
 Prokaryotic Type
   PCC21_002040
Mitochondrial biogenesis [BR:pcc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PCC21_002040
Exosome [BR:pcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PCC21_002040
  Exosomal proteins of breast cancer cells
   PCC21_002040
  Exosomal proteins of colorectal cancer cells
   PCC21_002040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
227921..229105
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNARAFDQIDNAPEEKARG
ITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPFIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVVRGSALKALE
GEAEWEAKIIELAEHLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgcaatcactaccgttctggctaaaacctac
ggtggtaacgcgcgtgcattcgaccagatcgataacgcgccagaagaaaaagcacgtggt
atcaccatcaacacgtctcacgttgaatacgataccccgtctcgccactacgcgcacgtt
gactgcccgggacacgccgactatgtgaaaaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggttgttgctgcgactgatggcccaatgcctcagacccgtgagcacatc
ctgctgggtcgtcaggttggcgttcctttcatcatcgtgttcctgaacaaatgtgacatg
gttgatgacgaagagctgctggaactggttgagatggaagtgcgtgagctgctgtctcag
tacgacttcccaggcgacgatactccagtggttcgtggttcagctctgaaagcgctggaa
ggcgaagctgagtgggaagcaaaaatcatcgaactggcagagcacctggattcttatatc
ccagaaccagagcgtgccattgacaagccgttcctgctgccaatcgaagacgtattctct
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcgttaaagtcggt
gaagaagttgaaatcgttggtatcaaagatacggcgaaatctacctgtactggcgtagaa
atgttccgcaaactgctggacgaaggtcgtgcaggcgagaacgttggtgttctgctgcgt
ggtatcaagcgtgaagaaatcgagcgtggtcaggtactggctaagccgggttcaatcaag
ccacacactcagttcgaatccgaagtgtatatcctgagcaaagatgaaggcggccgtcat
actccgttcttcaaaggctaccgtcctcagttctacttccgtacaactgacgtaacgggc
accatcgaactgccagaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccaatcgcgatggacgacggtttgcgtttcgccatccgtgaaggc
ggccgtacagtaggcgcgggcgttgttgctaaagttatcgcttaa

DBGET integrated database retrieval system