KEGG   Pseudomonas chlororaphis PA23: EY04_28775Help
Entry
EY04_28775        CDS       T03201                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
pch  Pseudomonas chlororaphis PA23
Brite
Translation factors [BR:pch03012]
 Eukaryotic Type
  Elongation factors
   EY04_28775 (tuf)
 Prokaryotic Type
   EY04_28775 (tuf)
Mitochondrial biogenesis [BR:pch03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    EY04_28775 (tuf)
Exosome [BR:pch04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   EY04_28775 (tuf)
  Exosomal proteins of breast cancer cells
   EY04_28775 (tuf)
  Exosomal proteins of colorectal cancer cells
   EY04_28775 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6310987..6312180)
Genome map
AA seq 397 aa AA seqDB search
MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSARVDFDKIDSAPEEKARG
ITINTAHVEYDSNIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSALMALN
GQDDNEMGTTAVKKLVETLDTYIPEPERAIDKPFLMPIEDVFSISGRGTVVTGRVERGIV
RIQEEVEIVGLRETQKTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPG
TVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
QMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKVIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaagaaaaatttgaacgtaacaaaccgcacgtcaacgttggcaccatcggtcac
gttgaccacggtaaaaccactctgactgctgctctgactcgtgtttgctccgaggttttc
ggttcggctcgcgttgacttcgacaagatcgacagcgccccagaagaaaaagctcgtggt
atcaccatcaacactgcgcacgtagagtacgactcgaacattcgtcactacgcgcacgtt
gactgcccaggtcacgccgactacgtcaaaaacatgatcactggtgctgcccagatggac
ggcgcgatcctggtttgctcggctgccgatggtccgatgccacaaactcgtgagcacatc
ctgctgtcccgtcaggtaggcgttccgtacatcgttgtcttcctgaacaaggctgacatg
gttgacgacgctgagctgctggaactggttgagatggaagtgcgcgatctgctgagcact
tacgacttcccgggtgatgacactccaatcatcatcggttcggctctgatggctctgaac
ggccaagacgacaacgaaatgggcactaccgctgttaagaagctggtagaaactctggat
acctacatcccagagccagagcgtgctatcgacaagccgttcctgatgcctatcgaagac
gtgttctcgatctccggtcgtggcaccgtggtaactggccgtgttgagcgtggtatcgtt
cgcatccaggaagaagttgagatcgttggtctgcgcgaaactcagaaaaccacctgcacc
ggcgttgaaatgttccgcaagctgctcgacgaaggtcgtgctggcgagaactgcggcgtt
ctgctgcgtggcaccaagcgtgacgacgttgagcgtggccaggttctggttaagccaggt
accgttaagccgcacaccaagttcaccgctgaagtgtacgttctgagcaaagaagaaggc
ggccgtcatactccgttcttcaaaggctaccgtccacagttctacttccgtactactgac
gtgactggtaactgcgagctgccagaaggcgttgaaatggtaatgccaggtgacaacatc
cagatgactgtcactctgatcaaaactatcgcgatggaagatggtctgcgtttcgctatc
cgtgaaggcggtcgtaccgtcggcgctggcgtcgtagctaaagtcatcgagtaa

DBGET integrated database retrieval system