KEGG   Propionibacterium acnes 6609: TIB1ST10_08010Help
Entry
TIB1ST10_08010    CDS       T02065                                 

Definition
(GenBank) sialidase precursor
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
pcn  Propionibacterium acnes 6609
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TIB1ST10_08010
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TIB1ST10_08010
Enzymes [BR:pcn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     TIB1ST10_08010
Bacterial toxins [BR:pcn02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   TIB1ST10_08010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1679681..1681189)
Genome map
AA seq 502 aa AA seqDB search
MTLTTKLSALAIAGIMAVIGAPMVTQSAMASGRAPAPDAATTQPKLVTGDITSTDQSGTH
LFFGKNIVRNAKGAIMKVDRTWPAAVPAPLSDVRADSSTRMLLGPVVDLAVNEHPAGVFY
RIPALATASNGDLLASYDLRPGSAADAPNPNSIVQRRSRDNGRTRGPQTVIHAGTLGRRK
VGYSDPSYLVDPATGHILNFHVKSYDRGFATSEVGTDPDDRHVLHAEVSTSTDNGHTWTY
RDITREITPDPTTRTRFVASGQGIALLHGPHAGRLIAQMTVRNSVGQQAQSIYSDDHGIT
WHAGNPVGRMMDENKVVELSDGTLMLNSRDAARSGRRKVAYSHDGGLTWGPVKLVDDLID
PTNNAQIIRAYPNARAGSAKARILLFTNARNATERVNGTLSVSCDDGRTWVSHQTYMPGE
VGYTTAAVQSDGALGVLWERDGIRYSTIPMGWLNSVCPVAPSGRPTSGEPTSGTSLPLTA
TPSGSLHGGASSRPTSLPHTGD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactttgaccacgaaactgagcgcgttggccattgccggaatcatggccgtcatcggg
gctcccatggtgacgcagtcagctatggcatcaggcagggctccggccccagatgcggcc
accacccagccgaagctcgtcacgggtgatatcaccagcaccgatcagtcgggcactcat
ctcttcttcggtaagaatatcgtccggaacgccaagggagccattatgaaagtcgaccgg
acatggcccgcagcagtgccggcacctctgtcggatgttcgtgctgattcgagcacacgg
atgctccttggccccgtcgtggatttggctgtcaatgagcatccggcaggtgttttttac
cgaatcccagcccttgcgaccgcttcgaacggcgatttgctggcctcctacgatctgcgt
ccggggagcgccgccgatgcgcctaaccccaattccatcgtgcagcgccgctctcgcgac
aacggtaggacgcggggtccgcaaaccgtcatccatgccgggaccctgggtcgcaggaag
gtgggatactccgatccttcctatctcgtcgatccagccacgggccacatcctcaatttt
cacgtgaagtcctacgacagaggattcgccacatcggaggtgggcacggacccggatgat
cgtcatgttctgcacgccgaggtctctacatcgaccgacaatggacacacttggacctat
cgagacatcacgcgcgagatcaccccggatcccaccactcggacacgattcgtggcatca
gggcagggcatagcgttgctccacggcccccacgctggacgtctcattgcccagatgacg
gtgcgcaacagtgtcggccaacaggcccagtcgatctattccgatgatcacggcatcacc
tggcatgctggcaacccggtgggccgaatgatggacgagaacaaggtggtggaactgtcc
gacggtaccctcatgctcaattccagggacgcagcccgttccggtcggcgcaaagtggcc
tattcccatgacggtggcttgacctgggggccggtgaagctggtcgacgacctcatcgac
cccaccaacaacgcccagatcattcgggcttaccccaatgcccgggccgggtcggcgaaa
gccaggatcctgttattcacgaatgcccgcaatgccacggaacgggtaaacggtaccctc
tcggtctcctgcgatgacggacggacatgggtcagtcatcagacctacatgcccggggaa
gtcggatacaccacggcagcggtgcagtctgacggggcgttgggcgttctgtgggagcgc
gacggtattcggtactccaccattccgatggggtggttgaattccgtgtgcccggtggct
ccttccgggaggccgacttctggagagccaacttctggcacatctctcccgcttactgcg
accccctccggttctcttcacggaggtgcctcgtcgcgtcccactagtttgccgcacaca
ggagactga

DBGET integrated database retrieval system