KEGG   Pectobacterium carotovorum subsp. carotovorum PC1: PC1_4065Help
Entry
PC1_4065          CDS       T00934                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pct  Pectobacterium carotovorum subsp. carotovorum PC1
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pct00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PC1_4065
  Energy metabolism
   00680 Methane metabolism
    PC1_4065
Enzymes [BR:pct01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PC1_4065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
4596925..4599564
Genome map
AA seq 879 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKEALGENILDKVETIRKLSKSSRAGNEKHRQELLTTL
QNLSNDELLPVARAFSQFLNLTNTAEQYHTISPHGEAASNPAQLSSAFERLKESKDLTER
DIRDAVESLSIELVLTAHPTEITRRTLIHKLVEVNTCLKQLDHNDLADYERNQIMRRLRQ
LIAQSWHTDEIRKIRPTPVDEAKWGFAVVENSLWEGVPAFLRELDEQLEQAFGYRLPVDA
VPVRFTSWMGGDRDGNPNVTAEVTRHVLLLSRWKAADLFLRDIQVLVSELSMSECTPELL
ELAGGSEVQEPYRAIMKSLRSQLSSTLSYLEARLTGEERLPPKDLLITNEQLWEPLHACY
QSLKSCGMGIIADGRLLDTLRRVRCFGVPLVRIDVRQESTRHTEALAEITRYLGLGDYES
WSESDKQAFLIRELSSKRPLLPRYWEPSADTKEVLDTCRVIAKAPQGSIAAYVISMARTP
SDVLAVHLLLKEAGCSFALPVAPLFETLDDLNNADDVMTQLLSIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYRAQDALIKTCEKAGIALTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLALYTGAILEANLLPPPEPKQEWHEVMDEL
SRVSCDMYRGYVRENPDFVPYFRAATPELELGKLPLGSRPAKRRPNGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVDDGKQEQLEEMCRDWPFFSTRIGMLEMVFAKADLWLAE
YYDQRLVDEKLWPLGKQLRDQLAADINIVLAISNDDHLMADLPWIAESIALRNVYTDPLN
VLQAELLHRSRQQEKPDADLELALMVTIAGVAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgcagtaacgtcagtatgctcggcaaactgctcggc
gacaccatcaaggaagcgctgggtgaaaatatccttgataaagtcgaaacaatccgcaag
ctgtcaaagtcttcccgcgcaggtaatgaaaaacatcgtcaggagttgctgaccacgctg
caaaacctgtctaacgatgaactgttgcccgttgcccgcgcattcagccagttccttaac
ctgaccaataccgctgagcaatatcatacgatttcaccgcacggtgaggcagcgagcaac
ccggcacagctttccagcgcctttgagcgtctgaaagaaagtaaagatctgaccgagcga
gatatccgtgacgccgtggaatcgctgtcgatcgaactggtgctgaccgcacacccgacc
gaaattacccgccggacgctgatccacaagctggtggaagtgaatacctgcctcaagcag
ctcgaccataacgatctggctgattatgaacgcaatcagatcatgcgtcgcttgcgccag
ctgatcgcgcagtcctggcacaccgatgagatccgtaaaattcgtcctaccccggtagat
gaagccaaatggggcttcgccgtggtggaaaacagcctgtgggaaggcgtccccgcgttt
ttacgcgagctggatgagcagttggaacaggctttcggctaccgtctgcccgttgacgcc
gttccggtacgctttacttcctggatgggcggcgaccgtgacggtaacccgaacgtgacg
gcagaagtgactcgccatgtgctgttactcagccgctggaaagccgccgatctgttcctg
cgtgatattcaggtgctggtttccgagctgtcgatgtccgaatgtacgccggagttgctg
gagctggctggtggtagcgaggttcaggaaccgtaccgcgccatcatgaaatcactgcgt
tcacagctgagcagtacgctgagctatctggaagcacgtctaacaggcgaagaacgtctg
ccacccaaagacctgctgattaccaacgaacagctttgggaaccgctccacgcctgctac
caatcactgaaatcctgcggcatgggcatcatcgccgatggtcgcctgctggatacgtta
cgtcgcgtgcgctgcttcggtgtgcctttggtccgcatcgatgtccgtcaggaaagcacc
cgtcacaccgaagcgctggctgaaattacccgctatctgggtctgggcgactacgaaagc
tggtcagagtccgacaagcaagccttcctgatccgcgaacttagctccaagcgtccgctt
ctgccgcgctactgggaacccagcgcggataccaaagaagtgctggatacctgtcgggtc
atcgctaaagcgccgcagggctctatcgccgcctacgttatttcaatggcacgcacgcct
tccgatgtgctggccgttcacctgctgctcaaagaagcgggctgctcgtttgccctgccg
gtcgcgccgctgtttgaaacgctggacgacctgaacaacgccgatgatgtcatgacgcaa
ttgctaagcatcgactggtatcgcggctttattcagggcaagcagatggtcatgatcggt
tattccgactccgcaaaagacgcgggcgtgatggccgcttcctgggcgcagtaccgtgca
caggatgccctgatcaaaacctgcgagaaagcgggtatcgcactgacgctgttccacgga
cgtggcggttccatcggtcgcggcggcgcgccggctcatgccgcgctgctgtcacaaccg
ccgggcagcctgaaaggcggcctgcgcgtgaccgaacagggcgagatgatccgctttaaa
tacggcctgccggaagtcaccatcagcagtctggcgttgtataccggtgcgattctggaa
gcgaacctgctgccaccaccggaaccaaaacaagaatggcacgaggtgatggatgaactg
tcccgcgtgtcctgtgatatgtaccgtggatacgtgcgtgagaacccggatttcgttcct
tacttccgcgctgcgacgccagagctggaactgggcaaactgccgctggggtcacgtccg
gccaagcgtcgtccgaacggcggcgtagaaagcctgcgcgctatcccgtggattttcgcc
tggacgcagaaccgtctgatgctgccagcctggctcggcgcgggtgccgcgttgcagaaa
gtggttgatgacggcaaacaggaacagctggaagagatgtgccgcgactggccgttcttc
tcaacgcgtatcggtatgctggagatggtgttcgccaaagccgacctgtggctggcggaa
tattacgatcagcgtctggtcgacgagaagctgtggccgttagggaaacagctgcgcgat
cagctggccgccgacatcaacatcgtgctggcgatctctaacgacgatcacttgatggcg
gatctgccgtggatcgcggaatcgatcgccttgcgtaacgtctacaccgatcccctgaac
gtgttgcaggccgagttgctgcatcgttcacgtcagcaggaaaaaccggatgccgatctg
gagctggcgttgatggtcaccatcgccggtgttgcagcaggtatgcgtaatacgggctaa

DBGET integrated database retrieval system