KEGG   Phoenix dactylifera (date palm): 103711471Help
Entry
103711471         CDS       T03274                                 

Definition
(RefSeq) hexokinase-2-like
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
pda  Phoenix dactylifera (date palm)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pda00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103711471
   00051 Fructose and mannose metabolism
    103711471
   00052 Galactose metabolism
    103711471
   00500 Starch and sucrose metabolism
    103711471
   00520 Amino sugar and nucleotide sugar metabolism
    103711471
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103711471
Enzymes [BR:pda01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103711471
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 526 aa AA seqDB search
MGKVAVGAAVVCAAAACAVAALVVRHRMRSSGRWARAMAILKDLEEKCATPIGKLRQVAD
AMTVEMLAGLASEGGSKLKMLISYVDNLPTGDETGLFYALDLGGTNFRVLRVQLGGKGGY
VVRQEFEEVSIPPNLMVGSSSELFDFIAAALAKFVASEGEEFHLPVGRQRELGFTFSFPV
KQTSISSGTLIKWTKGFAINGTVGEDVVAELTKAMEKQGLDMRVTALVNDTIGTLAGGRY
YDNDVVAAVILGTGTNAAYVEHAQAIPKWHGLLPKSGKMVINMEWGNFRSSHLPITEYDQ
ALDVESLNPGEQVISSSTSLSTKNWLFRFICTLFFYSQIFEKLISGMYLGEIVRRVLLRM
AEEAALFGDSVPPNLEVQFILRTPDMSAMHHDTSSDLRVVGTKLKDILGISNTSLKTRKL
VVKVCDIIASRGARLAAAGILGVLKKQDRDNAARDGSDMQRTVIAMDGGLYEHYTRFRNC
LETTLREMLGEEAAPSIVIKLASDGSGIGAALLAASHSQYLELEES
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggggaaggtggcggtgggagcggcggtggtgtgcgcggcggcggcatgcgcggtggcg
gcgctggtggtgcggcacaggatgcggagctccgggcggtgggcacgggcgatggcgata
ctgaaggacctggaggagaagtgcgccacgccgattgggaagctgaggcaggtggcggat
gcgatgaccgtggagatgctcgccggcctcgcttcggagggcgggagcaagctcaagatg
cttatcagctacgtcgataacctccccacaggagatgagacaggattgttttatgcattg
gaccttggaggaaccaacttccgtgtactacgtgtacaattgggaggaaagggagggtat
gttgtcaggcaagaatttgaagaagtttccattccaccaaatttgatggttggaagctcc
agtgaactatttgacttcattgctgcagcattggcaaagtttgttgcttcagaaggtgaa
gaatttcaccttcctgtgggcaggcagagagaacttggttttactttctctttccctgtg
aagcaaacatcgatctcgtctggcactcttattaagtggacaaagggttttgccattaat
ggcacggttggggaagatgtggtggctgagttgaccaaggccatggaaaagcaaggtctt
gatatgcgggttacagcattagtaaatgacacaattggcacattggctgggggcagatat
tacgataatgatgtggttgctgctgtcatactgggtactggaacaaatgcagcatatgta
gagcatgcacaagcaattcctaaatggcatgggcttttaccaaaatcaggaaagatggtt
atcaacatggaatggggaaatttcaggtcatctcatcttcctataacagaatacgatcaa
gcattagatgttgaaagtttgaatcctggtgaacaggtgatttcttcgtccacttctttg
agtacaaaaaattggttgttcagatttatatgtaccttatttttttattcccagatcttt
gagaagttaatttccggaatgtacttgggagaaattgtacgaagagtcctgttgagaatg
gctgaagaagctgccttgtttggagacagtgttccaccaaatcttgaagttcaatttata
ctgcggactccagacatgtcagccatgcatcatgacacatcatccgatctcagagttgtt
gggactaaactaaaggatattttagggatctctaatacctctttgaaaacaagaaagctg
gttgtcaaggtctgtgatatcattgccagtcgtggggcccgtctcgctgctgctggaata
ctgggcgtcttgaagaagcaggaccgtgataatgcagcaagggatggaagtgacatgcag
aggacagtgattgctatggacggtgggctttatgaacattacactagatttagaaattgt
ttggaaaccacactcagagagatgctcggagaagaggccgcaccgtctattgtcatcaag
cttgccagtgacggatcaggcattggagcagctctcctcgctgcatctcactctcagtat
cttgagcttgaagaatcctga

DBGET integrated database retrieval system