KEGG   Parabacteroides distasonis: BDI_0707Help
Entry
BDI_0707          CDS       T00549                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pdi  Parabacteroides distasonis
Pathway
pdi00240  Pyrimidine metabolism
pdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BDI_0707
Enzymes [BR:pdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BDI_0707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK Ribosomal_L37e
Motif
Other DBs
NCBI-ProteinID: ABR42477
UniProt: A6L9W3
LinkDB All DBs
Position
838443..839033
Genome map
AA seq 196 aa AA seqDB search
MTLPSEEHIFQYPGQGRIEVICGSMFSGKTEELIRRLKRAKFAKQRVEIFKPAIDTRYSQ
DNVVSHDSNSIPSTPVDSSSSILLFTSEIDVVGIDEAQFFDEGLVNVCNQLAANGIRVIV
AGLDMDYKGVPFGPMPELCAIADEVTKVHAICVKCGRLAYVSHRIVGNDKRVFLGEQSEY
EPLCRECYAKAEGLKN
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgacattgccttcagaagaacatatattccagtatccgggacaagggcggatcgaggtg
atttgcggttccatgttttccggtaagacggaggagcttatccgccgtttgaagcgggct
aaattcgccaagcagcgggtggagattttcaagcctgcgattgatacccgctattcgcag
gataacgtggtctcgcacgatagtaattcgattccttctactccggtggattcttcctcc
agtatcctattgttcacttccgagatcgatgtggtggggatagacgaggcccagtttttc
gatgagggattggtaaacgtgtgcaatcaattggccgctaacggtatccgggtgatcgtg
gctgggttggacatggactataagggagttcctttcggtcctatgccggagctatgcgct
atcgccgatgaggtgacgaaagtgcatgccatctgcgtgaaatgcggacgtttggcttac
gtatcccatcgtatcgtgggaaatgataaacgggtctttttaggggaacaatccgaatac
gagcctttatgccgggaatgctatgcgaaggctgaaggtttgaagaattga

DBGET integrated database retrieval system