KEGG   Parabacteroides distasonis: BDI_0931Help
Entry
BDI_0931          CDS       T00549                                 

Definition
(GenBank) glycoside hydrolase family 13, candidate alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pdi  Parabacteroides distasonis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BDI_0931
Enzymes [BR:pdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BDI_0931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1072620..1074068
Genome map
AA seq 482 aa AA seqDB search
MENGVMMQYFEWNLPNDGMLWKRLKDDASHLHEIGISAVWIPPAYKGHEQADEGYGTYDL
YDLGEFDQKGTIRTKYGTKQELQEMIEELHRNQIGVYLDAVMNHKAGADYTEWFMAQEVD
PGQRENATSEPHEIEGWTGFDFPGRGNMYSNFKWHWFHFSGTDYDVSRKKEGIFQILGEG
KHWSEGVDDENGNYDYLMFADLDFDNPEVVREMQDWGIWVSNELNLDGMRLDAIKHMNDQ
FIKHFLEAVRADRGEGFYAVGEYWKNDTESLEAYLSQVEYNVDLFDVALHYNLNEASEKG
RDYDLRDLLKGTLVEICPDQAVTFVDNHDSQKNSSLESQVKDWFKPSAYGLILLMKKGYP
CIFYGDYYGVKGKKSPHRKVLDMLLRARKEYAYGEEVDYFDHPNTIGFVRLGDSGHADSG
LALVISNGEDGEKTMSVGENRKGEVWHEITGSVKDTVAIDEEGKGRFLVKGGKLAVWVKV
KA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatggagtaatgatgcagtatttcgaatggaatctgccgaacgatggaatgctg
tggaaacggctgaaggatgatgcttcgcatttacatgagatcgggatcagcgccgtatgg
attccacccgcttacaaaggccatgagcaagcggacgaggggtatggaacctatgatcta
tatgatttgggggagtttgaccaaaaagggaccatacgtaccaagtatggaactaaacag
gaacttcaagaaatgatcgaggaacttcaccggaaccagattggcgtatatctggatgcc
gtgatgaaccataaggcgggagccgattataccgagtggtttatggcgcaagaggtagat
cctgggcaacgggaaaacgctaccagcgaaccccatgagatagagggctggaccggcttc
gacttcccggggcgtggcaatatgtattctaattttaaatggcattggtttcatttctcc
gggacggactatgatgtgtcccgcaagaaggaaggtatattccagattctgggagaggga
aaacattggagtgagggagtcgatgatgagaatggaaattatgactatctcatgttcgcc
gatctggatttcgataaccccgaagtcgtgcgtgagatgcaggactgggggatctgggta
tcgaacgaactaaacttggacggtatgcgccttgacgcgatcaagcatatgaacgaccag
tttatcaagcattttctggaggcggtgagagcggatcggggagagggtttctacgctgtc
ggggaatattggaaaaacgataccgaatcgttggaggcttacctgtcgcaagtagaatat
aacgtggatttgtttgacgtagccttacattataacttgaatgaggcttccgagaaaggt
cgtgactatgatttacgcgatctattaaaagggaccttggtcgagatatgcccggatcaa
gccgtcaccttcgtggataaccatgattcccagaaaaacagttctttggagtcgcaggta
aaggattggttcaaaccttccgcctacggtttgatcctgttgatgaagaaagggtatccg
tgcatcttttatggggattattatggcgtaaaagggaagaaatctccccatcgtaaggta
ttggatatgctattgcgtgcccggaaagaatatgcgtacggggaagaggtggattatttt
gatcatccgaacacgattggcttcgtacgcttgggagattcgggacatgctgattcgggc
ttggcgttggttatctcgaacggggaagatggagagaaaacaatgtctgtgggggagaac
cggaaaggcgaggtatggcatgagatcacaggctcggtaaaagataccgtggcgattgat
gaggaagggaaaggccgtttccttgtcaagggaggcaaattggctgtttgggtcaaggtc
aaggcttaa

DBGET integrated database retrieval system