KEGG   Pediococcus damnosus: ADU72_1729Help
Entry
ADU72_1729        CDS       T04321                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
pdm  Pediococcus damnosus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ADU72_1729
Enzymes [BR:pdm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ADU72_1729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1692601..1693191
Genome map
AA seq 196 aa AA seqDB search
MAQLFFHYGAMNSGKSIEILKVAHNYEEQHKSVVLMTSGIDTRKKVGEIASRIGLHRTAE
PIFDDTDIYKRVLELNPNAACLLIDEAQFLKKHHILELAKVVDDLNIPVMTFGLKNDFRN
ELFEGSKYLLIYADKIEEMKTICWFCKHKAIMNLRFANGKPVYEGEQVQIGGNEAYYPVC
RRHYFNPPLDEMRESK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
ttggcacagttattttttcactatggcgcaatgaatagcggtaaatcgatcgaaatttta
aaagttgctcataactacgaggaacaacataagtcggttgttttaatgactagcggaatc
gatacccgtaaaaaagttggcgagattgccagtcggattggtttgcatcgaacagcggag
cccatctttgatgatacggatatttataagcgggttttagagttaaatcccaatgcggcc
tgtttattgattgatgaggcgcaattcttaaaaaaacaccacattttagaactggccaaa
gtggtggatgatttgaacattccggtcatgacctttggattgaaaaatgattttcgtaat
gaactatttgaaggttctaaatatttgttaatttatgcggataaaatcgaagaaatgaag
acgatttgttggttctgtaagcataaggctattatgaacttgcgttttgcaaatggtaaa
ccagtgtatgaaggtgaacaggttcagattggtggtaatgaggcgtattatccagtttgt
cgtcgtcattatttcaatccgcctttggatgaaatgagggaaagtaagtaa

DBGET integrated database retrieval system