KEGG   Prevotella denticola: HMPREF9137_2237Help
Entry
HMPREF9137_2237   CDS       T01459                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pdn  Prevotella denticola
Pathway
pdn00240  Pyrimidine metabolism
pdn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pdn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    HMPREF9137_2237 (tdk)
Enzymes [BR:pdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     HMPREF9137_2237 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK Ribosomal_L37e
Motif
Other DBs
NCBI-ProteinID: AEA20574
UniProt: F2KY30
LinkDB All DBs
Position
complement(2630592..2631194)
Genome map
AA seq 200 aa AA seqDB search
MTTMDNLNGERRRQGRIEVICGSMFSGKTEELIRRMKRAEFARQKVEIFKPSIDTRYSDE
DVVSHDRNTIPSTPIDSSGNILLLASDIDVVGIDEAQFLDEGLTEVCNRLANNGVRVIIA
GLDMDYKGVPFGPIPALCAIADEVTKVHAICVKCGSLAYVSHRLIADERRVMLGEQQEYE
PLCRACYQEAIRKESLQKGK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgatggacaatctcaacggtgaaaggcgtcggcaggggcgcatagaagtgatt
tgtggaagtatgttctccggcaaaaccgaagagcttatccggcgtatgaagcgggcggag
tttgccagacagaaggtggaaatcttcaagccttccattgatacacgctattcggacgaa
gatgtggtcagccacgaccgcaacaccatcccttctacaccgattgactcgtccggcaac
attcttctccttgcctccgatatagatgtcgtcggcatcgacgaggcacagtttctggac
gaaggactgacagaggtctgcaaccggctggcgaacaatggggtgagggttatcattgcc
ggacttgacatggactacaaaggagtccccttcggccctatccccgccctgtgcgccatt
gccgacgaagtgacgaaggtgcatgccatctgcgtgaagtgcggctctctggcttacgtg
agccatcgccttattgccgacgagcggcgtgtcatgctgggcgaacagcaggaatacgaa
cctctgtgccgtgcctgttatcaggaagccatcaggaaggaaagcctgcagaaagggaaa
taa

DBGET integrated database retrieval system