KEGG   Penicillium digitatum: PDIP_76880Help
Entry
PDIP_76880        CDS       T04849                                 

Definition
(RefSeq) Elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pdp  Penicillium digitatum
Brite
Translation factors [BR:pdp03012]
 Eukaryotic Type
  Elongation factors
   PDIP_76880
 Prokaryotic Type
   PDIP_76880
Mitochondrial biogenesis [BR:pdp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PDIP_76880
Exosome [BR:pdp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PDIP_76880
  Exosomal proteins of breast cancer cells
   PDIP_76880
  Exosomal proteins of colorectal cancer cells
   PDIP_76880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 26236004
NCBI-ProteinID: XP_014531845
UniProt: K9G0F6
LinkDB All DBs
Position
Unknown
AA seq 440 aa AA seqDB search
MSTISRSLNLLVRTGRSSLLRPTAVNPIHHVFSNKVAGRGLATAFERNKPHVNIGTIGHV
DHGKTTLTAAITKNQASKGLANFLDYASIDKAPEERKRGITISTAHIEFATEDRHYAHVD
CPGHADYIKNMITGAANMDGAIVVVAASDGQMPQTREHLLLARQVGVQKIVVFVNKVDAV
EDPEMLELVELEMRELLSSYGFEGEETPIIFGSALCALEDRRPDIGAEQIDKLMKAVDTW
IPTPERDMDKPFLMSVEEVFSIPGRGTVVSGRVERGLLKKDTEVEIVGATDSGNPIKTKV
TDIETFKKSCDESRAGDNSGLLLRGVRREDIRRGMVVAAPNTTKANNKFLVSMYVLTEAE
GGRRTGFGANYRPQVYIRTADEAGDLSFPDGDMTRRVQPGDNVEMVLKTHHPVAAEPGQR
FNIREGGRTVATGLITRVVE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccatctcccgttccttgaacctcctggtgcgcactggccggtcctccctgctg
cgtccaactgccgtcaaccccatccaccatgtcttcagcaacaaggtggctggccgtgga
ttggccactgctttcgagcgcaacaagccccacgtgaacattggtacaattggtcacgtc
gatcacggcaagaccaccctgactgcggcaatcaccaagaaccaggcctctaagggtctt
gccaacttcctcgactatgcttccattgacaaggcccctgaggagcgcaagcgtggtatt
accatctcgactgcccacattgagttcgctaccgaggaccgccactacgcccacgtcgac
tgccccggtcacgccgactacattaaaaacatgattactggtgctgccaacatggatggt
gccattgttgtcgttgctgcctccgatggtcagatgccccagacccgcgagcacttgctg
cttgcccgtcaggttggtgttcaaaagattgttgtgttcgtcaacaaggtcgatgctgtg
gaggaccctgagatgctggagctcgttgagctcgagatgcgtgagctgctctcctcttac
gggttcgagggtgaggagactcctatcatcttcggctctgccctctgcgccctagaggat
cgccgccccgacattggtgctgagcagattgacaagctcatgaaggctgtcgacacctgg
atccccacccccgagcgtgatatggataagcctttccttatgtccgtggaggaggtcttc
tctatccctggtcgtggtactgttgtttctggccgtgtcgagcgtggtctcctgaagaag
gatactgaggttgaaattgtcggtgccaccgactccggcaaccctatcaagaccaaggtt
accgatattgagaccttcaagaagtcctgtgacgaatcccgtgccggtgataactccggt
cttctgctccgtggtgtccgccgtgaggacatccgccgcggcatggtcgttgctgcccct
aacactaccaaggccaacaacaagttcctcgtgtccatgtacgttttgaccgaggctgag
ggtggtcgccggactggtttcggtgccaactaccgccctcaggtctacatccgtactgct
gatgaggctggtgatctcagcttccctgatggcgacatgactagacgtgtccaacccggt
gacaacgttgagatggtcctcaagacccaccaccctgttgctgccgagcccggccagcgt
ttcaacatccgtgagggtggccgcaccgtcgccactggtctgattacccgtgtcgtcgag
taa

DBGET integrated database retrieval system